NEW - WESTERN DIGITAL 250GB 7200RPM SATA II 3.5INCH DESKTOP HARD DRIVE
Home ยป Shop by Category
Search Thousands of Computer Products Search Thousands of Computer Products

Software Support

S-264-2273 - - AD INTEGRATION FOR WEB CONTENT FILTER U2UA4E - HP 5Y SGLX X86 2P PCA SVC
SHIPPING - - SHIPPING U2UA5E - HP 5Y SGLX X86 4-8P PCA SVC
SWS-SOTIMC-10 - 1 YEAR SOFTWARE SUPPORT FOR SOTI U7RS9E - HP 5Y STOREFRONTSV LTU PROACT SW SVC
LIC-CAM-NAS-1CH - 1 CAMERA LICENSE ACTIVATION KEY FOR SURVEILLANCE STATION PRO FOR QNAP NAS U2SB3E - HP 5Y SW TECH SUPP WIN24X7 FC SVC
VIR-SUPP-SC40-1MO-GOLD - 1 MO GOLD SERVERCACHE (ONE SERVER) U2SB5E - HP 5Y SW TECH SUPP WIN24X7 FC SVC
VIR-SUPP-SC40-1MO-PLATINUM - 1 MO PLATINUM SERVERCACHE (ONE SERVER) U2SA9E - HP 5Y SW TECH SUPP WIN24X7 FC SVC
WMS1MBASIC - 1 MONTH INFRASTRUXURE CENTRAL BASIC SOFTWARE SUPPORT CONTRACT U2SB1E - HP 5Y SW TECH SUPP WIN24X7 FC SVC
WMS1MOVM - 1 MONTH STRUXUREWARE CENTRAL SOFTWARE U2SB7E - HP 5Y SW TECH SUPP WIN24X7 FC SVC
SNV-CT-100 - 1 UNIT CO-TERM SUPPORT, NTIER VERDE 4U U6GT5E - HP 5Y VMVSPH ENT VSM ENTPLSUPG1P PCA SVC
YXPPCL-S - 1 Y PMA FOR XPROT PRO CAM LIC -S U6GT9E - HP 5Y VMW HORIZON SUITE10PK PCA SVC
YXPSWBL-S - 1 Y PMA FOR XPROT SMTWLL BSLIC -S U6GT7E - HP 5Y VMW HORIZON VIEW10PK PCA SVC
WMS1YR10N - 1 YEAR 10 NODE INFRASTRUXURE CENTRAL SOFTWARE SUPPORT CONTRACT. AN EXTENSION OF U6GU1E - HP 5Y VMW HORIZON VW ADDON10P PCA SVC
WMS1YR100N - 1 YEAR 100 NODE INFRASTRUXURE CENTRAL SOFTWARE SUPPORT CONTRACT U6GT8E - HP 5Y VMW HORIZON WRKSPCE10P PCA SVC
WMS1YR1000N - 1 YEAR 1000 NODE INFRASTRUXURE CENTRAL SOFTWARE SUPPORT CONTRACT U6GU0E - HP 5Y VMW MW VCNTR OPSVW10P PCA SVC
WMS1YR500N - 1 YEAR 500 NODE INFRASTRUXURE CENTRAL SOFTWARE SUPPORT U6GR6E - HP 5Y VMW THIN APP CLIENT 100PK PCA SVC
FC-10-0066D-311-02-12 - 1 YEAR 8X5 FORTICARE CONTRACT U6GW8E - HP 5Y VMW VCAC 6ADV 25 OSI PK PCA SVC
ABMDSTCN-TOSH1 - 1 YEAR ABSOLUTE MANAGE U6GW9E - HP 5Y VMW VCAC 6ENT 25 OSIPK PCA SVC
SSPG-1 - 1 YEAR ANNUAL SW SUPPORT PLAN U6GP7E - HP 5Y VMW VCLOUD DIR 25VM PCA SVC
T00218-SVC - 1 YEAR ARS-C WARRANTY EXTENSION FOR STORAGELIBRARY T24 (WARRANTY EXTENSION FOR Y U6GS3E - HP 5Y VMW VCLOUD SUITE ADVANCED PCA SVC
FC-10-0VM00-114-02-12 - 1 YEAR AS SERVICE U6GS4E - HP 5Y VMW VCLOUD SUITE ENT PCA SVC
FC-10-VVM01-100-02-12 - 1 YEAR AV SVC U6GS2E - HP 5Y VMW VCLOUD SUITE STANDARD PCA SVC
FC-10-0VM00-100-02-12 - 1 YEAR AV SVC U6GR8E - HP 5Y VMW VCNTR OPS ADV 25OSI PCA SVC
ICWA1YCC - 1 YEAR EXTENDED WARRANTY U6GR9E - HP 5Y VMW VCNTR OPS ENT 25OS PCA SVC
ICWA1YCD - 1 YEAR EXTENDED WARRANTY U6GR7E - HP 5Y VMW VCNTR OPS STANDARD25VM PCA SVC
ICWA1YCB - 1 YEAR EXTENDED WARRANTY U6GR0E - HP 5Y VMW VIEW ENT ADDON 10PK PCA SVC
ICWA1YCE - 1 YEAR EXTENDED WARRANTY U6GR1E - HP 5Y VMW VIEW ENT ADDON100PK PCA SVC
ICWA1YCA - 1 YEAR EXTENDED WARRANTY U6GQ6E - HP 5Y VMW VIEW ENT BNDL 100PK PCA SVC
FC-10-C0103-151-02-12 - 1 YEAR FORTICLIENT LICENSE SUBSCRIPTION FOR UP TO 2,000 CLIENTS ON FG 100-800 SE U6GQ5E - HP 5Y VMW VIEW ENT STR KT10PK PCA SVC
FC-10-VVM01-137-02-12 - 1 YEAR FORTIWEB SECURITY SERVICE U6GR3E - HP 5Y VMW VIEW PRM ADDON100PK PCA SVC
WMS1YRBASIC - 1 YEAR INFRASTRUXURE CENTRAL BASIC SOFTWARE SUPPORT CONTRACT U6GR2E - HP 5Y VMW VIEW PRM ADDON10PK PCA SVC
10161-45 - 1 YEAR MAINTENANCE DONGLE 21512 U6GQ8E - HP 5Y VMW VIEW PRM BNDL 100PK PCA SVC
RG1-3010 - 1 YEAR OF ADDITONAL SUPPORT FOR 3010 U6GQ7E - HP 5Y VMW VIEW PRM STR KT10PK PCA SVC
GD1-3010 - 1 YEAR OF ADDITONAL SUPPORT FOR 3010 U6GS9E - HP 5Y VMW VSOM ENT KIT6P PCA SVC
GD1-3030 - 1 YEAR OF ADDITONAL SUPPORT FOR 3030 U6GT0E - HP 5Y VMW VSOM ENT PLUS KIT6 P PCA SVC
RG1-3030 - 1 YEAR OF ADDITONAL SUPPORT FOR 3030 U6GW3E - HP 5Y VMW VSOM ENT-ENTPLSUPG 5YPCA SVC
RG1-3050 - 1 YEAR OF ADDITONAL SUPPORT FOR 3050 U6GW1E - HP 5Y VMW VSOM ENT-VCLD ADV UPGPCA SVC
GD1-3050 - 1 YEAR OF ADDITONAL SUPPORT FOR 3050 U6GW2E - HP 5Y VMW VSOM ENT-VCLD ENTUPG PCA SVC
GD1-3100 - 1 YEAR OF ADDITONAL SUPPORT FOR 3100 U6GW0E - HP 5Y VMW VSOM ENT-VCLD STD UPG PCA SVC
RG1-3100 - 1 YEAR OF ADDITONAL SUPPORT FOR 3100 U6GW5E - HP 5Y VMW VSOM ENTPLS VCLD ADV UPPCA SVC
RG1-3250 - 1 YEAR OF ADDITONAL SUPPORT FOR 3250 U6GW6E - HP 5Y VMW VSOM ENTPLS VCLD ENTUPPCA SVC
GD1-3250 - 1 YEAR OF ADDITONAL SUPPORT FOR 3250 U6GW4E - HP 5Y VMW VSOM ENTPLS VCLD STD UPPCA SVC
RG1-3500 - 1 YEAR OF ADDITONAL SUPPORT FOR 3500 U6GS7E - HP 5Y VMW VSOM ENTPLUS1P PCA SVC
RG1-3900 - 1 YEAR OF ADDITONAL SUPPORT FOR 3900 U6GS8E - HP 5Y VMW VSOM STD KIT6P PCA SVC
EMS-R - 1 YEAR RENEWAL FOR SUMMA HEALTH ONLY; 2012 U6GV8E - HP 5Y VMW VSOM STD VCLD ADV UPG PCA SVC
SMIFS1R12800180 - 1 YEAR RENEWAL OF IFS SOFTWARE MAINTAIN U6GV9E - HP 5Y VMW VSOM STD VCLD ENT UPG PCA SVC
SMIFS1R12X00 - 1 YEAR RENEWAL OF IFS SOFTWARE MAINTAIN U6GN8E - HP 5Y VMW VSPH CNT RSRV STD PCA SVC
SMIFS1R12800040 - 1 YEAR RENEWAL OF IFS SOFTWARE MAINTAIN U6GP1E - HP 5Y VMW VSPH CNTR CRGBCK 25VMPCA SVC
SMIFS1R12800360 - 1 YEAR RENEWAL OF IFS SOFTWARE MAINTAIN U6GP0E - HP 5Y VMW VSPH CNTR SRV HRTBT PCA SVC
SMA-IFS12X00 - 1 YEAR RENEWAL OF IFS SOFTWARE MAINTENANCE U6GN9E - HP 5Y VMW VSPH CNTRSRV FNDSTD UP PCA SVC
SMIFS1R12800120 - 1 YEAR RENEWAL OF IFS SOFTWARE MORE U6GR4E - HP 5Y VMW VSPH DSKTP 100VM PCA SVC
SPM1-100 - 1 YEAR SERVICE CONTRACT, S/W UPDATES- U6GN3E - HP 5Y VMW VSPH ENT PLS 1P PCA SVC
SMALV21 - 1 YEAR SMA - LABELVIEW NETWORK U6GP8E - HP 5Y VMW VSPH ENT PLUS 32P PCA SVC
SMALVRT - 1 YEAR SMA - LABELVIEW RUNTIME U6GT4E - HP 5Y VMW VSPH ENT VSM ENT UPG1P PCA SVC
SMACS21 - 1 YEAR SMA - CODESOFT NETWORK - 21 TO 50 U6GT6E - HP 5Y VMW VSPH ENTPLSVSMENTPLUG1P PCASVC
SMALM11 - 1 YEAR SMA - LABEL MATRIX NETWORK - 11 U6GT2E - HP 5Y VMW VSPH STD VSOM ENTUPG1P PCA SVC
SMALM21 - 1 YEAR SMA - LABEL MATRIX NETWORK - 21 U6GT1E - HP 5Y VMW VSPH STD VSOM STD UPG1P PCASVC
SMALM10 - 1 YEAR SMA - LABEL MATRIX NETWORK - LESS U6GT3E - HP 5Y VMW VSPH STDVSM ENTPLSUPG1P PCASVC
SMALMRT - 1 YEAR SMA - LABEL MATRIX RUNTIME U6GQ1E - HP 5Y VMW VSPHCNTRSRMSTDENT25VM PCA SVC
SMALMS - 1 YEAR SMA - LABEL MATRIX SINGLE USER U6GN7E - HP 5Y VMW VSPHCNTRSRV FND PCA SVC
SMALV11 - 1 YEAR SMA - LABELVIEW NETWORK U6GS0E - HP 5Y VMW VSPHERE 2X ENT 1P 1XIC PCA SVC
SMALV10 - 1 YEAR SMA - LABELVIEW NETWORK - LESS U6GS1E - HP 5Y VMW VSPHERE 2X ENT PLUS1 PCA SVC
SMALVS - 1 YEAR SMA - LABELVIEW SINGLE USER U6GN2E - HP 5Y VMW VSPHERE ENT 1P PCA SVC
SMACS10 - 1 YEAR SMA- CODESOFT NETWORK U6GN1E - HP 5Y VMW VSPHERE STD 1P PCA SVC
SMACS11 - 1 YEAR SMA- CODESOFT NETWORK - 11 TO 20 U6GV6E - HP 5Y VMW VSPHESSPLSVSMENTPSUPG6PPCA SVC
SMACSRT - 1 YEAR SMA- CODESOFT RUNTIME U6GV5E - HP 5Y VMW VSPHESSPLSVSMENTUPG6PPCA SVC
SMACSS - 1 YEAR SMA- CODESOFT SINGLE USER U6GV7E - HP 5Y VMW VSPHMSTD-VCLDSDUPPCA SVC
SMIFS1R7X241152 - 1 YEAR SOFTWAR U6GR5E - HP 5Y VMWARE THIN APP SUITE PCA SVC
SMIFS1R7X242304 - 1 YEAR SOFTWAR U6GZ8E - HP 5Y VMWARE VSAN 1P PCA SVC
WOPS1YR200 - 1 YEAR SOFTWARE MAINTENANCE CONTRACT U6GS6E - HP 5Y VMWARE VSOM ENT1P PCA SVC
WOPS1YR10 - 1 YEAR SOFTWARE MAINTENANCE CONTRACT U6GS5E - HP 5Y VMWARE VSOM STD1P PCA SVC
WCHM1YR10 - 1 YEAR SOFTWARE MAINTENANCE CONTRACT U6GN0E - HP 5Y VMWARE VSPHERE ESS PCA SVC
SWMAINT1E-BCU10U - 1 YEAR SOFTWARE MAINTENANCE EXTENSION U6GP4E - HP 5Y VMWV SPH STD-ENT UPG1P PCA SVC
SWMAINT1E-BCAMSH - 1 YEAR SOFTWARE MAINTENANCE EXTENSION U2V17E - HP 5Y24X7 NTWKSW GP120 PROACTCARE SW SVC
SWMAINT1E-BCU510 - 1 YEAR SOFTWARE MAINTENANCE EXTENSION U2V77E - HP 5Y24X7 NTWKSW GP175 PROACTCARE SW SVC
SWMAINT1E-BCU5U - 1 YEAR SOFTWARE MAINTENANCE EXTENSION U6HH2E - HP 5Y24X7 SW MSL6480CONTROL/PATH PCA SVC
SWMAINT1E-BCAVM - 1 YEAR SOFTWARE MAINTENANCE EXTENSION UT548E - HP 5Y24X7 VMW VSP E+ 32P 1Y24X7 LIC SUPP,VMW VSPHERE EPLUS 32P 1YR 24X7 NM LIC ,
SWMAINT1E-BCAAG - 1 YEAR SOFTWARE MAINTENANCE EXTENSION H6S08AAE - HP 6M LANDESK ADV DPLYMTACCEL ALM E LTU
SWMAINT1R-BCU5U - 1 YEAR SOFTWARE MAINTENANCE YEAR 2/3 H6S10AAE - HP 6M LANDESK ADVDPLYMT ACCEL SSM E LTU
SWMAINT1R-BCU10U - 1 YEAR SOFTWARE MAINTENANCE YEAR 2/3 UU959E - HP BLADESYSTEM MATRIX EXP KIT IMPL SVC,BLADESYSTEM MATRIX EXPANSION KIT,STARTUP
SWMAINT1R-BCAMSH - 1 YEAR SOFTWARE MAINTENANCE YEAR 2/3 UU960E - HP BLADESYSTEM MATRIX UPG IMP SVC
SWMAINT1R-BCAAG - 1 YEAR SOFTWARE MAINTENANCE YEAR 2/3 UU961E - HP BLADESYSTEM MATRIX UPG W/MIGR IMP SVC
SWMAINT1R-BCU510 - 1 YEAR SOFTWARE MAINTENANCE YEAR 2/3 U9983E - HP CARE PACK 1YR PRO ESNTL 9X5 25 INCLUDE SW MICROSOFT
SWMAINT1R-BCAVM - 1 YEAR SOFTWARE MAINTENANCE YEAR 2/3 JL020AAE - HP CLOUD NETWORK MANAGER 1 YEAR E-LTU
WCAM1YR1000 - 1 YEAR SOFTWARE MNT CONTRACT 1000 RACKS JL021AAE - HP CLOUD NETWORK MANAGER 3 YEAR E-LTU
WMS1YRVM - 1 YEAR STRUXUREWARE CENTRAL SOFTWARE H4W56E - HP CLOUDSYSTEM ENTERPRISE SW STARTUP SVC
ICTS1YCC - 1 YEAR TECH SUPPORT LICENSE H4W55E - HP CLOUDSYSTEM FOUNDATION SW STARTUP SVC
ICTS1YCE - 1 YEAR TECH SUPPORT LICENSE H4W57E - HP CLOUDSYSTEM SOLUTION STARTUP SVC
ICTS1YCB - 1 YEAR TECH SUPPORT LICENSE U9980E - HP CP 1Y Pro Esntl 24x7,25 SW Incd MSFT
ICTS1YCD - 1 YEAR TECH SUPPORT LICENSE U9977E - HP CPe 1Y Pro Esntl 24x7,50 SW Incd MSFT
ICTS1YCA - 1 YEAR TECH SUPPORT LICENSE U9986E - HP CPe 1Y Pro Esntl 9x5,10 SW Incd MSFT
VIR-SUPP-SC40-1YR-GOLD - 1 YR GOLD SERVERCACHE (ONE SERVER) UA386E - HP e-Care Pack extended service agreement - 1 year
FC-10-VVM01-140-02-12 - 1 YR IRIS SERVICE UA384E - HP e-Care Pack extended service agreement - 1 year
VIR-SUPP-SC40-1YR-PLATINUM - 1 YR PLATINUM SERVERCACHE (ONE SERVER) UA385E - HP eCare Pack 24x7 Software Technical Support - Red Hat Linux IA-32 technical su
0A35121 - 1 YR. 24/7 SUPPORT RENEWAL FOR SECUREDOC UA387E - HP eCare Pack 24x7 Software Technical Support - Red Hat Linux IA-32 technical su
FBSU1000IM - 1,000,000 IMAGE U9981E - HP eCare Pack Mission Critical Support Proactive Essentials Incident - Red Hat L
ASR5001 - 1-3 DOCTORS FOR FIREWALL, IPS, WCF, WEB U9984E - HP eCare Pack Mission Critical Support Proactive Essentials Incident - Red Hat L
WMS1YR25N - 1-YEAR 25 NODE INFRASTRUXURE CENTRAL SOFTWARE SUPPORT CONTRACT U9987E - HP eCare Pack Mission Critical Support Proactive Essentials Incident - Red Hat L
902016-30 - 1-YEAR ADVANCE REPLACEMENT LCD WINTERM TERMINAL (3650LE/9650XE) U9978E - HP eCare Pack Mission Critical Support Proactive Essentials Incident - Red Hat L
WMS1YRENT - 1-YEAR INFRASTRUXURE CENTRAL ENTERPRISE SOFTWARE SUPPORT CONTRACT U9979E - HP eCare Pack Mission Critical Support Proactive Essentials Incident - SuSE Linu
WMS1YRSTD - 1-YEAR INFRASTRUXURE CENTRAL STANDARD SOFTWARE SUPPORT CONTRACT U9988E - HP eCare Pack Mission Critical Support Proactive Essentials Incident - SuSE Linu
GLD-SW-1000 - 1-YEAR MAINTENANCE SOFTWARE GOLD FOR CSN U9982E - HP eCare Pack Mission Critical Support Proactive Essentials Incident - SuSE Linu
951-104-41-1VREN - 1-YEAR RENEWAL - BROOKTROUT SR140-12F U9985E - HP eCare Pack Mission Critical Support Proactive Essentials Incident - SuSE Linu
951-104-42-1VREN - 1-YEAR RENEWAL - BROOKTROUT SR140-24F H2872E - HP Electronic SupportPack Installation Service
951-104-38-1VREN - 1-YEAR RENEWAL - BROOKTROUT SR140-2F HA453A1-021 - HP FCTRY EXP STRG AND NTWKING PKG 3 SVC
951-104-39-1VREN - 1-YEAR RENEWAL - BROOKTROUT SR140-4F JG763AAE - HP IMC APM SW MOD ADD 25-MONITOR E-LTU
951-104-40-1VREN - 1-YEAR RENEWAL - BROOKTROUT SR140-8F JG753AAE - HP IMC UAM SW MOD ADD 50-USER E-LTU
GFI2XCFAXREN - 1-YEAR RENEWAL - XCAPI 2 LINE QL803B - HP INSIGHT CMU 1YR 24X7 FLEX LIC
GFI4XCFAXREN - 1-YEAR RENEWAL - XCAPI 4 LINE BD476A - HP INSIGHT CMU 3YR 24X7 FLEX LIC
GFI8XCFAXREN - 1-YEAR RENEWAL - XCAPI 8 LINE UV431E - HP INSTALL 1 DIGITAL SIGN SOLUTION SVC
SWMAIN1E-S1K - 1-YEAR SOFTWARE MAINT, 1000 UV432E - HP INSTALL 2+ DIGITAL SIGN SOLUTION SVC
SWMAIN1E-S11 - 1-YEAR SOFTWARE MAINT, 1100 H6S25AAE - HP LANDESK ALM TRAINING E LTU
SWMAIN1E-S12K - 1-YEAR SOFTWARE MAINT, 12000 H6S47AAE - HP LANDESK BOOTCAMP TRAININGUK GBP E LTU
SWMAIN1E-S14K - 1-YEAR SOFTWARE MAINT, 14000 H6S26AAE - HP LANDESK BOOTCAMPTRAINING SVC E LTU
SWMAIN1E-S15K - 1-YEAR SOFTWARE MAINT, 15000 H6S46AAE - HP LANDESK BOOTCAMPTRAININGEU EUR E LTU
SWMAIN1E-S18K - 1-YEAR SOFTWARE MAINT, 18000 H6S44AAE - HP LANDESK PROFESSIONAL SVC EUONLY E LTU
SWMAIN1E-S2K - 1-YEAR SOFTWARE MAINT, 2000 H6S45AAE - HP LANDESK PROFESSIONAL SVC UKONLY E LTU
SWMAIN1E-S22 - 1-YEAR SOFTWARE MAINT, 2200 H6S12AAE - HP LANDESK PROFSERVICES ALM SVC E LTU
SWMAIN1E-S41 - 1-YEAR SOFTWARE MAINT, 4100 H6S14AAE - HP LANDESK PROFSERVICES SSM SVC E LTU
SWMAIN1E-S42 - 1-YEAR SOFTWARE MAINT, 4200 H6S35AAE - HP LANDESK PROSVC ALM EU EUR ONLY E LTU
SWMAIN1E-S44 - 1-YEAR SOFTWARE MAINT, 4400 H6S36AAE - HP LANDESK PROSVC ALM UK GBP ONLY E LTU
SWMAIN1E-S45 - 1-YEAR SOFTWARE MAINT, 4500 H6S41AAE - HP LANDESK PROSVC SSM EU EUR ONLY E LTU
SWMAIN1E-S510 - 1-YEAR SOFTWARE MAINT, 510 H6S42AAE - HP LANDESK PROSVC SSM UK GBP ONLY E LTU
SWMAIN1E-S520 - 1-YEAR SOFTWARE MAINT, 520 H6S15AAE - HP LANDESK PROSVCS DAILY EXPENSE E LTU
SWMAIN1E-S550 - 1-YEAR SOFTWARE MAINT, 550 H6S27AAE - HP LANDESK TRAIN ONSITE 5 DAYSSVC E LTU
SWMAIN1E-S620 - 1-YEAR SOFTWARE MAINT, 620 H6S18ATE - HP LANDESKSECURTYSTESTNALONE PROMO E LTU
SWMAIN1E-S650 - 1-YEAR SOFTWARE MAINT, 650 TC235B - HP MATRIXOE NON-HP 1-SVR 24X7 SUPP
SWMAIN1E-S50 - 1-YEAR SOFTWARE MAINT, S50 TC226BAE - HP MATRIXOE NON-HP E-LTU 24X7 SUPP
SWMAIN1E-SD10 - 1-YEAR SOFTWARE MAINT, SD 10 TC236B - HP MATRIXOE NON-HP FLEX QTY 24X7 SUPP
SWMAIN1E-SD30 - 1-YEAR SOFTWARE MAINT, SD 30 TC237BAE - HP MATRIXOE NON-HP TRACK 24X7 SUPP
730979-04 - 1-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY TC230B - HP MATRIXOE UPGR FRM IC PL FLEX24X7 SUPP
730801-13 - 1-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY TC231BAE - HP MATRIXOE UPGR FRM IC PL TRAK24X7 SUPP
730958-05 - 1-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY TC229B - HP MATRIXOE UPGR FRM IC PL1SVR 24X7 SUPP
730939-14 - 1-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY TC234B - HP MATRIXOE UPGR FRM IC PLE-LTU24X7 SUPP
5325302147 - 1-YEAR SUPPLEMENTAL, EDR, 210 TC227BAE - HP MATRIXOE W/IC PL BNDL 8-SVR E-LTU SW
5325302148 - 1-YEAR SUPPLEMENTAL, EDR, 410 TC228B - HP MATRIXOE W/IC PL E-LTU 24X7 SUPP
5325302152 - 1-YEAR SUPPLEMENTAL, EDR, 650 TC224B - HP MATRIXOE W/IC PL FLEX QTY 24X7 SUPP
5325302158 - 1-YEAR SUPPLEMENTAL, EDR, UNIX TC225BAE - HP MATRIXOE W/IC PL TRACK 24X7 SUPP
5325302157 - 1-YEAR SUPPLEMENTAL, EDR, WIN/LINUX HA113A1#5NG - HP MSA2000 SW INSTALLATION
902016-22 - 1-YEAR WARRANTY EXTENSION (RTD) WINTERM X235LE UK260E - HP MSA2000 SW INSTALLATION SVC ,MSA2000 SOFTWARE,INSTALLATION FOR STORAGE SOFTWA
902016-32 - 1-YEAR WARRANTY EXTENSION (RTD) WINTERM LCD INTEGRATED (3650LE/9650XE) 516474-B21 - HP SA ADV PACK NM FLEX 1 YR 24X7 SUPP
902016-24 - 1-YEAR WARRANTY EXTENSION (RTD) WINTERM X125SE & X150SE D8S85AAE - HP SECURE ENCRYPTION E-LTU 24X7 SUPP LIC
902016-21 - 1-YEAR WARRANTY EXTENSION (RTD) WINTERM X2X0LE D8S84A - HP SECURE ENCRYPTION FLEX 24X7 SUPP LIC
902016-26 - 1-YEAR WARRANTY EXTENSION (RTD) WINTERM X450XE, X455XL, 941GXL BB095ACE - HP SGLX ADVANCED X86 1Y24X7 PSL E-LTU
902016-31 - 1-YEAR WARRANTY WITH ADVANCE REPLACEMENT LCD WINTERM (3650LE/9650XE) HA114A1#5TR - HP STARTUP 3PAR 7400 UPGRD ND PAIR SVC
902016-18 - 1-YEAR WARRANTY WITH ADVANCE REPLACEMENT X125SE & X150SE HA124A1#55Q - HP STARTUP D2D BACKUP SYSTEM SVC
902016-16 - 1-YEAR WARRANTY WITH ADVANCE REPLACEMENT X235LE UU089E - HP STARTUP D2D BACKUP SYSTEM SVC ,D2D BACKUP SYSTEM,INSTALL & STARTUP OF D2D BAC
902016-15 - 1-YEAR WARRANTY WITH ADVANCE REPLACEMENT X2X0LE UC629E - HP Startup File and Print Server SVC ProLiant Servers
902016-20 - 1-YEAR WARRANTY WITH ADVANCE REPLACEMENT X450XE, X455XL, 941GXL UF369E - HP STARTUP INSIGHT CONTROL ENVIRON SVC ,HP INSIGHT CONTROL ENVIRONMENT,INSTALL &
FBSU10CC - 10 CONCURRENT USERS UT857E - HP STARTUP INSIGHT CTRL SYSTEM CTR SVC,INSIGHT CONTROL FOR SYSTEM CENTER,INSTALL
FBSU10000IM - 10,000,000 IMAGE UT858E - HP STARTUP INSIGHTCTRL VMWAR VCENTER SVC,INSIGHT CONTROL FOR VMWARE VCENTER,INST
OFS-SS100000-1Y - 100,000 FAX PAGES INBOUND OR OUTBOUND IN 1YR FOR DMR U8141E - HP Startup Linux Server O/S SVC ,Linux Server Operating Systems,Installation and
FBSU100KIM - 100,000 IMAGE HA124A1#55R - HP STARTUP STOREONCE ADDITIONAL SVC
7015884-7311-FYM-ENT - 1001 TO 1500 UNITS FYM ENT SUPRT UF815E - HP STARTUP SVR MIG PK-SMP- 1 SERVER SVC ,HP SERVER MIGRATION PACK,INSTALL & STAR
7015884-7324-FYM-ENT - 1001 TO 1500 UNITS FYM ENT SUPRT UF816E - HP STARTUP VIRTUAL CONNECT ENT MGR SVC ,HP VIRTUAL CONNECT ENTERPRISE MANAGER,I&
7015886-7324-FYM-STD - 1001 TO 1500 UNITS FYM STD SUPRT UF367E - HP STARTUP VMWARE VIRTL INFRA ENTPR SVC ,VMWARE VIRTUAL INFRASTRUCTURE-ENTERPRIS
7015886-7311-FYM-STD - 1001 TO 1500 UNITS FYM STD SUPRT UF370E - HP Startup VMware Virtl Infra Startr SVC,VMware Virtual Infrastructure-Starter,I
7015884-7317-FYM-ENT - 101 TO 150 UNITS FYM ENT SUPRT UF366E - HP STARTUP VMWARE VIRTL INFRA STD SVC ,VMWARE VIRTUAL INFRASTRUCTURE-STANDARD,IN
7015884-7304-FYM-ENT - 101 TO 150 UNITS FYM ENT SUPRT HA124A1#5NS - HP STARTUP VMWARE VSPHERE ENTERPRISE SVC
7015886-7317-FYM-STD - 101 TO 150 UNITS FYM STD SUPRT UK837E - HP STARTUP VMWARE VSPHERE ENTERPRISE SVC,VSPHERE ENTERPRISE (OR ENTERPRISE PLUS)
7015886-7304-FYM-STD - 101 TO 150 UNITS FYM STD SUPRT UK835E - HP STARTUP VMWARE VSPHERE ESSL-STD SVC,VSPHERE ESSENTLS, ESSENTLS+ OR STANDARD,I
7015884-7301-FYM-ENT - 11-20 UNITS FYM ENT SUPRT D4T73A - HP STOREEASY WSS2012 R2 STD ED UPG KIT
7015884-7314-FYM-ENT - 11-20 UNITS FYM ENT SUPRT HA124A1#58H - HP TECH STARTUP LH INT LTU SVC
7015886-7301-FYM-STD - 11-20 UNITS FYM STD SUPRT HA124A1#58K - HP TECH STARTUP LH P4K LTU SVC
7015886-7314-FYM-STD - 11-20 UNITS FYM STD SUPRT H2S86A1 - HP TIPPINGPOINT IPS EXPERT OST
DSI-CMSUPPORTTA - 12 MONTHS SOFTWARE SUPPORT HK697A1#Q0K - HP TIPPINGPOINT VSMS VMWARE VSPHERE SVC
SS1005-23738 - 12 MOS. SW SUPPORT JC887AAE - HP TP DVLABS DV FOR S1050F 1-YR E-LTU
21198680 - 12.X ADMIN TRNG BNDL LED TRNG CERT U0RA1E - HP VMWARE VSOM STARTUP ENT SVC,VMWARE,INSTALLATION AND STARTUP VMWARE VSPHERE OP
FBSU15CC - 15 CONCURRENT USERS U2SN9E - HP3Y24X7SGLXEX862P4-8P1Y247FPL24X7FC SVC
FBSU150IM - 150,000 IMAGE U2SP0E - HP4Y24X7SGLXEX862P4-8P1Y24X7FPL247FC SVC
7015884-7318-FYM-ENT - 151 TO 200 UNITS FYM ENT SUPRT U2SP1E - HP5Y24X7SGLXEX862P4-8P1Y24X7FPL247FC SVC
7015884-7305-FYM-ENT - 151 TO 200 UNITS FYM ENT SUPRT 43W4434 - I/P SERVICES S/W UPGD LIC.-CISCO CATALYS
7015886-7318-FYM-STD - 151 TO 200 UNITS FYM STD SUPRT LSC5H-AEDL-000A - I500 ILAYER EDLM LICENSE
7015886-7305-FYM-STD - 151 TO 200 UNITS FYM STD SUPRT LSC5H-UKMA-L4HA - I500 KMIP KEY MANAGER LIC KEY,10 DRIVE
4ZK0E82601 - 18 MO. 24/7 SECUREDOC ENTERPRISE CLIENT LSC5H-UKM2-L4HA - I500 KMIP KEY MANAGER LIC KEY,2 DRIVE
HZ827AAE - 1Y LANDESK MGMT SVC 1K-1999 E-LTU LSC5H-UKM4-L4HA - I500 KMIP KEY MANAGER LIC KEY,4 DRIVE
EMS-R - 1YEAR RENEWAL FOR RIVERVIEW HOSPITAL2011 LSC5H-UKM6-L4HA - I500 KMIP KEY MANAGER LIC KEY,6 DRIVE
SMIFS1R7X2424 - 1YEARSOFTWARE 4099L - IGNITE UI LATE RENEWAL PENALTY
SMIFS1R7X24576 - 1YEARSOFTWARE 4099PE - IGNITE UI PRIORITY SUPPORT EXTENSION
SMIFS1R7X2448 - 1YEARSOFTWARE 40990P - IGNITE UI PRIORITY SUPPORT RENEWAL
SMIFS1R7X24288 - 1YEARSOFTWARE IMAGE-INS-LOADSW - IMAGE BLAST, INSTALLATION OF RAM AND LOAD SOFTWARE FOR ENCRYPTION
SMIFS1R7X2496 - 1YEARSOFTWARE 21210973-27A-G-36-Y3 - IMBAND G 36 MONTH YEAR 3
SMIFS1R7X24144 - 1YEARSOFTWARE LAQLTR.4.IMP - IMPLEMENTATION
SWMAINT1U-BCA2 - 1YR 24X7 SUPPORT EXT 4-HR OSS RESPONSE 21220479 - IMPLEMENTATION SERVICES
730957-01 - 1YR MAINT & SUP SYGATE AGENT AFTER INIT AGR EXP 124967-IM - IMPLEMENTATION, CONFIGURATION PER DAY
LICMX80EN1YR-SS - 1YR MERAKI MX80 ENT LIC QTY 23 21211038-26 - IMSS SETUP
SWS-SOTIMC-20 - 2 YEAR SOFTWARE SUPPORT FOR SOTI PSP1200.213 - IN-COUNTRY TERMS; 1 YR RENEWABLE: 24/7 TECHNICAL CUSTOMER SUPPORT IF MISSION C
LIC-CAM-NAS-2CH - 2 CAMERA LICENSE ACTIVATION KEY FOR SURVEILLANCE STATION PRO FOR QNAP NAS 7015471-7017607-ENT - IN-DATABASE AOFYM ENT SUPRT
CPTS-PRO-2D-OTS - 2 DAY ACCESS TO ONLINE TRAINING SYSTEM E 7015470-7017607-STD - IN-DATABASE AOFYM STD SUPRT
CPTS-PRO-2D-JS - 2 DAYS JUMP START POINTSEC FOR PC UNDER 7015471-7017624-ENT - IN-MEMORY DATABASES FYM ENT SUPRT
FC-10-0VM00-966-02-24 - 2 YEAR 24X7 FORTICARE PLUS FORTIGUARD BUNDLE CONTRACT 7015470-7017624-STD - IN-MEMORY DATABASES FYM STD SUPRT
FC-10-VVM02-935-02-24 - 2 YEAR 8X5 FORTICARE PLUS AV, FORTIWEB SECURITY SERVICE, & IP REPUTATION CF-SVCSWDEVDAILY - INCLUDES ON DAY (8HRS) OF SOFTWARE DEVELOPMENT CONSULTING.
ABMDSTCN-TOSH2 - 2 YEAR ABSOLUTE MANAGE CF-SVCSWDEVSPRNT - INCLUDES TWO BUSINESS WEEKS (10 DAYS) OF SOFTWARE DEVELOPMENT CONSULTING.
RG2-3010 - 2 YEAR OF ADDITONAL SUPPORT FOR 3010 A199L - INDIGO STUDIO LATE RENEWAL PENALTY
GD2-3010 - 2 YEAR OF ADDITONAL SUPPORT FOR 3010 A19900 - INDIGO STUDIO RENEWAL
GD2-3030 - 2 YEAR OF ADDITONAL SUPPORT FOR 3030 INCONX6SD1YR - INFOCUS CONX CLOUD VIDEO
RG2-3030 - 2 YEAR OF ADDITONAL SUPPORT FOR 3030 INCONX12SD1YR - INFOCUS CONX CLOUD VIDEO
RG2-3050 - 2 YEAR OF ADDITONAL SUPPORT FOR 3050 7015471-7017651-ENT - INFORMATIONARCHITECT (CS) FYM ENT SUPRT
GD2-3050 - 2 YEAR OF ADDITONAL SUPPORT FOR 3050 7015470-7017651-STD - INFORMATIONARCHITECT (CS) FYM STD SUPRT
GD2-3100 - 2 YEAR OF ADDITONAL SUPPORT FOR 3100 7015471-7014155-ZFL - INFORMATIONARCHITECT-FLOATING LIC
RG2-3100 - 2 YEAR OF ADDITONAL SUPPORT FOR 3100 919900 - INFRAGISTICS NETADV ULTIMATE 2012
RG2-3250 - 2 YEAR OF ADDITONAL SUPPORT FOR 3250 WCHM1M200 - INFRASTRUXURE CHANGE, 1 MONTH SOFTWARE
GD2-3250 - 2 YEAR OF ADDITONAL SUPPORT FOR 3250 WCHM1M10 - INFRASTRUXURE CHANGE, 1 MONTH SOFTWARE
RG2-3500 - 2 YEAR OF ADDITONAL SUPPORT FOR 3500 WEE1YR - INFRASTRUXURE ENERGY EFFICIENCY
RG2-3900 - 2 YEAR OF ADDITONAL SUPPORT FOR 3900 WNSC010101 - INFRASTRUXURE MANAGEMENT SOFWARE
LJP-RE-P5-WIN-24 - 2 YEAR PREMIUM FG1210-02 - INSPIRED XPERT CORPORATE TEMPLATE
FC-10-0066D-311-02-24 - 2 YEARS 8X5 FORTICARE CONTRACT CSIN0033 - INSTALL CUSTOMER LICENSE OF MICROSOFT WI
FBSU2000IM - 2,000,000 IMAGE U5717E - Installation & Start-up
730958-03 - 2-YEAR SOFTWARE MAINTENANCE I-550-2448 - INSTALLATION - EVENT MONITORING & RESPON
730958-06 - 2-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY I-551-2448 - INSTALLATION - EVENT MONITORING & RESPON
730939-15 - 2-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY I-554-2448 - INSTALLATION - EVENT MONITORING & RESPON
730801-14 - 2-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY I-552-2448 - INSTALLATION - EVENT MONITORING & RESPON
902016-53 - 2-YEAR WARRANTY EXTENSION (RTD) WINTERM X125SE & X150SE I-553-2448 - INSTALLATION - EVENT MONITORING & RESPON
902016-59 - 2-YEAR WARRANTY EXTENSION (RTD) WINTERM LCD INTEGRATED (3630LE/3650XE/8630LE/96 I-550-2509 - INSTALLATION - HIPAA ESSENTIAL - EXTRA S
902116-26 - 2-YEAR WARRANTY EXTENSION (RTD) WINTERM S CLASS I-550-2572 - INSTALLATION - HIPAA ESSENTIAL - EXTRA S
902116-27 - 2-YEAR WARRANTY EXTENSION (RTD) WINTERM V CLASS I-553-2509 - INSTALLATION - HIPAA ESSENTIAL - LARGE E
902016-51 - 2-YEAR WARRANTY EXTENSION (RTD) WINTERM X235LE I-553-2572 - INSTALLATION - HIPAA ESSENTIAL - LARGE E
902016-50 - 2-YEAR WARRANTY EXTENSION (RTD) WINTERM X2X0LE I-552-2509 - INSTALLATION - HIPAA ESSENTIAL - MEDIUM
902016-55 - 2-YEAR WARRANTY EXTENSION (RTD) WINTERM X450XE, X455XL, 941GXL I-551-2572 - INSTALLATION - HIPAA ESSENTIAL - SMALL E
902016-58 - 2-YEAR WARRANTY WITH ADVANCE REPLACEMENT LCD WINTERM (3650LE/9650XE) I-551-2509 - INSTALLATION - HIPAA ESSENTIALS - SMALL
902016-60 - 2-YEAR WARRANTY WITH ADVANCE REPLACEMENT WINTERM 3820TX (TABLET) I-552-2516 - INSTALLATION - MANAGED FIREWALL - UP TO
902016-47 - 2-YEAR WARRANTY WITH ADVANCE REPLACEMENT X125SE & X150SE I-553-2516 - INSTALLATION - MANAGED FIREWALL - UP TO
902016-45 - 2-YEAR WARRANTY WITH ADVANCE REPLACEMENT X235LE I-554-2529 - INSTALLATION - MANAGED FIREWALL - UP TO
902016-44 - 2-YEAR WARRANTY WITH ADVANCE REPLACEMENT X2X0LE I-551-2529 - INSTALLATION - MANAGED FIREWALL - UP TO
902016-46 - 2-YEAR WARRANTY WITH ADVANCE REPLACEMENT X360SE I-550-2516 - INSTALLATION - MANAGED FIREWALL - UP TO
902016-48 - 2-YEAR WARRANTY WITH ADVANCE REPLACEMENT X440XL I-554-2516 - INSTALLATION - MANAGED FIREWALL - UP TO
902016-49 - 2-YEAR WARRANTY WITH ADVANCE REPLACEMENT X450XE, X455XL, 941GXL I-553-2529 - INSTALLATION - MANAGED FIREWALL - UP TO
FBSU20CC - 20 CONCURRENT USERS I-552-2529 - INSTALLATION - MANAGED FIREWALL - UP TO
FBSU20000IM - 20,000,000 IMAGE I-550-2529 - INSTALLATION - MANAGED FIREWALL - UP TO
BW-200-STBY-SUPP - 200 USER LICENSE I-551-2516 - INSTALLATION - MANAGED FIREWALL - UP TO
7015884-7306-FYM-ENT - 201 TO 250 UNITS FYM ENT SUPRT I-550-2357 - INSTALLATION - MANAGED GATEWAY AV - UP T
7015884-7319-FYM-ENT - 201 TO 250 UNITS FYM ENT SUPRT I-554-2582 - INSTALLATION - MANAGED GATEWAY AV - UP T
7015886-7306-FYM-STD - 201 TO 250 UNITS FYM STD SUPRT I-551-2357 - INSTALLATION - MANAGED GATEWAY AV - UP T
7015886-7319-FYM-STD - 201 TO 250 UNITS FYM STD SUPRT I-552-2357 - INSTALLATION - MANAGED GATEWAY AV - UP T
7015884-7315-FYM-ENT - 21 TO 50 UNITS FYM ENT SUPRT I-550-2582 - INSTALLATION - MANAGED GATEWAY AV - UP T
7015884-7302-FYM-ENT - 21 TO 50 UNITS FYM ENT SUPRT I-551-2582 - INSTALLATION - MANAGED GATEWAY AV - UP T
7015886-7302-FYM-STD - 21 TO 50 UNITS FYM STD SUPRT I-552-2582 - INSTALLATION - MANAGED GATEWAY AV - UP T
7015886-7315-FYM-STD - 21 TO 50 UNITS FYM STD SUPRT I-553-2582 - INSTALLATION - MANAGED GATEWAY AV - UP T
EU400-000 - 24 X 7 COVERAGE I-553-2357 - INSTALLATION - MANAGED GATEWAY AV - UP T
FC-10-L1004-247-02-24 - 24X7 2 YEAR FORTICARE CONTRACT FOR FAZ-1000D I-554-2357 - INSTALLATION - MANAGED GATEWAY AV - UP T
WS24X7HDGFIRM - 24X7 HELP DESK PER SEAT AND GFI MAX I-554-2512 - INSTALLATION - MANAGED IDPS - UP TO 1 GI
FBSU25CC - 25 CONCURRENT USERS I-554-2527 - INSTALLATION - MANAGED IDPS - UP TO 1 GI
FBSU250IM - 250,000 IMAGE I-550-2527 - INSTALLATION - MANAGED IDPS - UP TO 10 M
7015884-7307-FYM-ENT - 251 TO 300 UNITS FYM ENT SUPRT I-550-2512 - INSTALLATION - MANAGED IDPS - UP TO 10 M
7015884-7320-FYM-ENT - 251 TO 300 UNITS FYM ENT SUPRT I-551-2527 - INSTALLATION - MANAGED IDPS - UP TO 100
7015886-7320-FYM-STD - 251 TO 300 UNITS FYM STD SUPRT I-552-2527 - INSTALLATION - MANAGED IDPS - UP TO 250
7015886-7307-FYM-STD - 251 TO 300 UNITS FYM STD SUPRT I-552-2512 - INSTALLATION - MANAGED IDPS - UP TO 250
ST-SEC2FAM99 - 2FA MAINTENANCE & SUPPORT (1-99 USERS) I-553-2512 - INSTALLATION - MANAGED IDPS - UP TO 500
ST-SEC2FAM499 - 2FA MAINTENANCE & SUPPORT (100-499 USERS) I-553-2527 - INSTALLATION - MANAGED IDPS - UP TO 500
ST-SEC2FAM4999 - 2FA MAINTENANCE & SUPPORT (1000-4999 USERS) I-554-2412 - INSTALLATION - MANAGED WCF - UP TO 1 GIG
ST-SEC2FAM24999 - 2FA MAINTENANCE & SUPPORT (10000-24999 USERS) I-554-2583 - INSTALLATION - MANAGED WCF - UP TO 1 GIG
ST-SEC2FAM49999 - 2FA MAINTENANCE & SUPPORT (25000-49999 USERS) I-550-2583 - INSTALLATION - MANAGED WCF - UP TO 10 MB
ST-SEC2FAM999 - 2FA MAINTENANCE & SUPPORT (500-999 USERS) I-550-2412 - INSTALLATION - MANAGED WCF - UP TO 10 MB
ST-SEC2FAM9999 - 2FA MAINTENANCE & SUPPORT (5000-9999 USERS) I-551-2583 - INSTALLATION - MANAGED WCF - UP TO 100 M
2FA-151-1K - 2FA ONE SDK 1 YR MAINTENANCE & SUPPORT I-551-2412 - INSTALLATION - MANAGED WCF - UP TO 100 M
2FA-151-01 - 2FA ONE SDK 1 YR MAINTENANCE & SUPPORT I-552-2412 - INSTALLATION - MANAGED WCF - UP TO 250 M
2FA-103-1K - 2FA ONE, 1 YR MAINTENANCE & SUPPORT I-552-2583 - INSTALLATION - MANAGED WCF - UP TO 250 M
2FA-103-5K - 2FA ONE, 1 YR MAINTENANCE & SUPPORT I-553-2583 - INSTALLATION - MANAGED WCF - UP TO 500 M
2FA-103-50K - 2FA ONE, 1 YR MAINTENANCE & SUPPORT I-553-2412 - INSTALLATION - MANAGED WCF - UP TO 500 M
2FA-103-10K - 2FA ONE, 1 YR MAINTENANCE & SUPPORT PS001 - INSTALLATION AND DEPLOYMENT ASSISTANCE FOR NAVIGO SOFTWARE
2FA-103-01 - 2FA ONE, 1 YR MAINTENANCE & SUPPORT AQTC-ITR-R - INSTALLATION AND TRAINING/REMOTE PER DAY
2FA-103-500 - 2FA ONE, 1 YR MAINTENANCE & SUPPORT CSIN0020 - INSTALLATION OF FTSERVER SYSTEM SOFTWARE
2FA-103-100K - 2FA ONE, 1 YR MAINTENANCE & SUPPORT 21210984-26A-A-12 - INSTANT MESSAGING SAFE.CLOUD BAND A 12MO
2FA-103-25K - 2FA ONE, 1 YR MAINTENANCE & SUPPORT 21210984-26A-A-36-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND A Y1
2FA-103-100 - 2FA ONE, 1 YR MAINTENANCE & SUPPORT 21210984-26A-A-24-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND A Y1
2FA-104-50K - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-A-36-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND A Y2
2FA-104-100K - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-A-24-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND A Y2
2FA-104-5K - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-A-36-Y3 - INSTANT MESSAGING SAFE.CLOUD BAND A Y3
2FA-104-10K - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-B-12 - INSTANT MESSAGING SAFE.CLOUD BAND B 12MO
2FA-104-25K - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-B-24-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND B Y1
2FA-104-100 - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-B-36-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND B Y1
2FA-104-1K - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-B-36-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND B Y2
2FA-104-01 - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-B-24-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND B Y2
2FA-104-500 - 2FA ONE, 2 YRS MAINTENANCE & SUPPORT 21210984-26A-B-36-Y3 - INSTANT MESSAGING SAFE.CLOUD BAND B Y3
2FA-105-01 - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-C-12 - INSTANT MESSAGING SAFE.CLOUD BAND C 12MO
2FA-105-25K - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-C-24-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND C Y1
2FA-105-100K - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-C-36-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND C Y1
2FA-105-100 - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-C-36-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND C Y2
2FA-105-50K - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-C-24-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND C Y2
2FA-105-10K - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-C-36-Y3 - INSTANT MESSAGING SAFE.CLOUD BAND C Y3
2FA-105-1K - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-D-12 - INSTANT MESSAGING SAFE.CLOUD BAND D 12MO
2FA-105-500 - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-D-36-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND D Y1
2FA-105-5K - 2FA ONE, 3 YRS MAINTENANCE & SUPPORT 21210984-26A-D-24-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND D Y1
2FA-108-01 - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-D-24-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND D Y2
2FA-108-500 - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-D-36-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND D Y2
2FA-108-10K - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-D-36-Y3 - INSTANT MESSAGING SAFE.CLOUD BAND D Y3
2FA-108-25K - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-E-12 - INSTANT MESSAGING SAFE.CLOUD BAND E 12MO
2FA-108-100K - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-E-24-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND E Y1
2FA-108-50K - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-E-36-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND E Y1
2FA-108-100 - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-E-24-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND E Y2
2FA-108-1K - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-E-36-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND E Y2
2FA-108-5K - 2FA ONE, 5 YRS MAINTENANCE & SUPPORT 21210984-26A-E-36-Y3 - INSTANT MESSAGING SAFE.CLOUD BAND E Y3
2FA-120-100 - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-F-12 - INSTANT MESSAGING SAFE.CLOUD BAND F 12MO
2FA-120-100K - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-F-36-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND F Y1
2FA-120-01 - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-F-24-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND F Y1
2FA-120-500 - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-F-36-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND F Y2
2FA-120-25K - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-F-24-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND F Y2
2FA-120-50K - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-F-36-Y3 - INSTANT MESSAGING SAFE.CLOUD BAND F Y3
2FA-120-1K - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-G-12 - INSTANT MESSAGING SAFE.CLOUD BAND G 12MO
2FA-120-10K - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-G-36-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND G Y1
2FA-120-5K - 2FA ONECLOUD BUNDLED PER USER PER MONTH 21210984-26A-G-24-Y1 - INSTANT MESSAGING SAFE.CLOUD BAND G Y1
2FA-121-500 - 2FA ONECLOUD ONE-TIME SETUP FEE 21210984-26A-G-24-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND G Y2
2FA-121-5K - 2FA ONECLOUD ONE-TIME SETUP FEE 21210984-26A-G-36-Y2 - INSTANT MESSAGING SAFE.CLOUD BAND G Y2
2FA-121-1K - 2FA ONECLOUD ONE-TIME SETUP FEE 21210984-26A-G-36-Y3 - INSTANT MESSAGING SAFE.CLOUD BAND G Y3
2FA-121-10K - 2FA ONECLOUD ONE-TIME SETUP FEE 7008441-7017720-ENT - INTEGRATION NUL ADD-ON FYM ENT SUPRT
2FA-121-50K - 2FA ONECLOUD ONE-TIME SETUP FEE 7010282-7017720-STD - INTEGRATION NUL ADD-ON FYM STD SUPRT
2FA-121-100 - 2FA ONECLOUD ONE-TIME SETUP FEE IIU000S - INTELLIJIDEA 1-YEAR UPGRADE SUBSCRIPTION FOR V12 LICENSE
2FA-121-100K - 2FA ONECLOUD ONE-TIME SETUP FEE 4601 - IPMONITOR LEGACY UNLIMIITED - MAINTENANC
2FA-121-01 - 2FA ONECLOUD ONE-TIME SETUP FEE 4606 - IPMONITOR WITH UP TO 500 MONITORS - ANNU
2FA-121-25K - 2FA ONECLOUD ONE-TIME SETUP FEE 4605 - IPMONITOR WITH UP TO 500 MONITORS - LICE
2FA-106-160 - 2FA PROFESSIONAL SERVICES IPSEC-50-STBY-SU - IPSEC VPN OPTION
2FA-106-01 - 2FA PROFESSIONAL SERVICES IPSEC-200-STBY-S - IPSEC VPN OPTION
2FA-106-24 - 2FA PROFESSIONAL SERVICES IPSEC-UL-STBY-SU - IPSEC VPN OPTION
2FA-106-40 - 2FA PROFESSIONAL SERVICES BW-IPSEC-200-SUPP - IPSEC VPN OPTION
ST-SEC2FAPS8 - 2FA PROFESSIONAL SERVICES, HOURLY RATE - DOESNOT INCLUDE TRAVEL AND EXPENSES. BW-IPSEC-50-SUPP - IPSEC VPN OPTION FOR 50 USER FIREWALL
2FA-106-TE - 2FA PROFESSIONAL SERVICES,TRAVEL&EXPENSE BW-IPSEC-UL-SUPP - IPSEC VPN OPTION FOR UNLIMITED FIREWALL
2FA-203-1K - 2FA PROTECTDRIVE,1YR MAINTENANCE&SUPPORT FG1200-11 - IS-COMP5-SERV, 10 USER EDITION
2FA-203-5K - 2FA PROTECTDRIVE,1YR MAINTENANCE&SUPPORT WITO1M10 - IT OPT 1 MON SW MANT CONTRACT 10 RACKS
2FA-203-01 - 2FA PROTECTDRIVE,1YR MAINTENANCE&SUPPORT WITO1M100 - IT OPT 1 MON SW MANT CONTRACT 100 RACKS
2FA-203-500 - 2FA PROTECTDRIVE,1YR MAINTENANCE&SUPPORT WITO1M200 - IT OPT 1 MON SW MANT CONTRACT 200 RACKS
2FA-203-100 - 2FA PROTECTDRIVE,1YR MAINTENANCE&SUPPORT WITO1M500 - IT OPT 1 MON SW MANT CONTRACT 500 RACKS
2FA-203-10K - 2FA PROTECTDRIVE,1YR MAINTENANCE&SUPPORT WITO1YR10 - IT OPT 1 Y SWMANT CONTRACT 10 RACKS
2FA-204-10K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITO1YR100 - IT OPT 1 Y SWMANT CONTRACT 100 RACKS
2FA-205-100 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITO1YR200 - IT OPT 1 Y SWMANT CONTRACT 200 RACKS
2FA-205-10K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITO1YR500 - IT OPT 1 Y SWMANT CONTRACT 500 RACKS
2FA-208-100 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITO3YR10 - IT OPT 3 Y SWMANT CONTRACT 10 RACKS
2FA-204-01 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITO3YR100 - IT OPT 3 Y SWMANT CONTRACT 100 RACKS
2FA-205-1K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITO3YR200 - IT OPT 3 Y SWMANT CONTRACT 200 RACKS
2FA-204-100 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT AP91601000 - IT OPTIMIZE 1000 RACK LICENSE
2FA-204-1K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC1M100 - IT PW CONTL 1 M SW MAINT 100 RACKS
2FA-208-1K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC1M10 - IT PW CONTL 1 M SW MAINT. 10 RACKS
2FA-208-10K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC1M200 - IT PW CONTL 1 MONTH SW MAINT 200 RACKS
2FA-205-01 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC1M500 - IT PW CONTL 1 MONTH SW MAINT 500 RACKS
2FA-205-5K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC1YR100 - IT PW CONTL 1 Y SW MAINT 100 RACKS
2FA-204-500 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC1YR200 - IT PW CONTL 1 Y SW MAINT 200 RACKS
2FA-205-500 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC1YR500 - IT PW CONTL 1 Y SW MAINT 500 RACKS
2FA-208-01 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC3YR10 - IT PW CONTL 3 Y SW MAINT 10 RACKS
2FA-204-5K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC3YR100 - IT PW CONTL 3 Y SW MAINT 100 RACKS
2FA-208-5K - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC3YR200 - IT PW CONTL 3 Y SW MAINT 200 RACKS
2FA-208-500 - 2FA PROTECTDRIVE,2YRS MAINT &SUPPORT WITPC3YR500 - IT PW CONTL 3 Y SW MAINT 500 RACKS
ST-SEC2FASDK - 2FA SOFTWARE DEVELOPERS KIT SDK WITPC1YR10 - IT PW CONTLL 1 Y SW MAINT 10 RACKS
ST-SEC2FA99 - 2FAONE-USLIC-XX (1-99 PER SEAT LICENSES) IT-MAINT - IT-MAINT COVERING ONE (1) YEAR FROM DATE OF DELIVERY, INCLUDES ITEXT TECHNICAL S
ST-SEC2FA499 - 2FAONE-USLIC-XX (100-499 PER SEAT LICENSES) IT-MAINT-REN - IT-MAINT-REN COVERING ONE (1) YEAR FROM DATE OF RENEWAL INCLUDES ITEXT TECHNICAL
ST-SEC2FA9999 - 2FAONE-USLIC-XX (1000-4999 PER SEAT LICENSES) IT-MAINT-RF - IT-MAINT-RF REPRESENTS THE RE-INSTATEMENT FEE FOR THE LAPSE OF COVERAGE PERIOD B
ST-SEC2FA49999 - 2FAONE-USLIC-XX (10000-24999 PER SEAT LICENSES) IT-MAINT-SP - IT-MAINT-SP INCLUDES SPECIAL CONSIDERATION FOR ITEXT TECHNICAL SUPPORT AND ACCES
ST-SEC2FA4999 - 2FAONE-USLIC-XX (500-999 PER SEAT LICENSES) IT-MAINT-UPG - IT-MAINT-UPG COVERING ONE (1) YEAR FROM DATE OF LICENSE UPGRADE INCLUDES ITEXT T
ST-SEC2FA24999 - 2FAONE-USLIC-XX (5000-9999 PER SEAT LICENSES) 20-50-10 - ITALKIE CLIENT SUPPORT & MAINTENANCE
90000-AP2-BFMC - 2ND YEAR M&S 20-50-11 - ITALKIE CLIENT SUPPORT & MAINTENANCE
DOCWEBS-HOST50-MN - 2ND YEAR MAINTENANCE 20-50-12 - ITALKIE CLIENT SUPPORT & MAINTENANCE
90008-AS2 - 2ND YEAR PREPAID M&S ON DP PRO ENTERPRISE 5.0 20-50-13 - ITALKIE CLIENT SUPPORT & MAINTENANCE
SM-SVSAN-CPM2-1 - 2TB VIRTUAL SAN LICENSES FOR ONE SERVER AND WITH FULL HA AND VCENTER MANAGEMENT 20-51-10 - ITALKIE/DS SUPPORT & MAINTENANCE: 1 YEAR
730801-11 - 2YR PRIORITY PLUS SUPPORT AND MNT FOR RAPPORT V4.0 4.4 WORKGROUP 20-51-12 - ITALKIE/DS SUPPORT & MAINTENANCE: 2 YEAR
SWS-SOTIMC-30 - 3 YEAR SOFTWARE SUPPORT FOR SOTI 20-51-13 - ITALKIE/DS SUPPORT & MAINTENANCE: 3 YEAR
LIC-CAM-NAS-3CH - 3 CAMERA LICENSE ACTIVATION KEY FOR SURVEILLANCE STATION PRO FOR QNAP NAS 20-51-11 - ITALKIE/DS SUPPORT & MAINTENANCE: 3 YEAR
EC-SVS-CATALYST - 3 DAY ON-SITE INSTALLATION, CONFIGURATION, AND TUNING OF PBS-CATALYST 20-60-20 - ITALKIE/PA SUPPORT & MAINTENANCE: 1 YEAR
CPTS-PRO-3D-JS - 3 DAYS JUMP START POINTSEC FOR PC UNDER 20-60-22 - ITALKIE/PA SUPPORT & MAINTENANCE: 2 YEAR
Y3XPCOBT-S - 3 Y PMA FOR XPROT CORP BSSVR -S 20-60-21 - ITALKIE/PA SUPPORT & MAINTENANCE: 3 YEAR
Y3XPPBL-P - 3 Y PMA FOR XPROT PRO BSLIC -P 20-60-23 - ITALKIE/PA SUPPORT & MAINTENANCE: 3 YEAR
Y3XPPCL-G - 3 Y PMA FOR XPROT PRO CAM LIC -G MCT2739RN - JBOSS ENTERPR OPENSHIFT PREMIUM, 2 CORE
Y3XPPCL-P - 3 Y PMA FOR XPROT PRO CAM LIC -P MCT2739F3RN - JBOSS ENTERPR OPENSHIFT PREMIUM, 2 CORE
FC-10-0VM00-966-02-36 - 3 YEAR 24X7 FORTICARE PLUS FORTIGUARD BUNDLE CONTRACT MCT2748F3RN - JBOSS ENTERPR OPENSHIFT ENTERP 2 CORE
FC-10-VVM02-935-02-36 - 3 YEAR 8X5 FORTICARE PLUS AV, FORTIWEB SECURITY SERVICE, & IP REPUTATION MCT2748F3 - JBOSS ENTERPR OPENSHIFT ENTERPR 2 CORE
ABMDSTCN-TOSH3 - 3 YEAR ABSOLUTE MANAGE MCT2748F3 - JBOSS ENTERPR OPENSHIFT ENTERPR 2 CORE
ICWA3YCB - 3 YEAR EXTENDED WARRANTY MCT2865RN - JBOSS ENTERPR OPENSHIFT ENTERPR STADD
ICWA3YCD - 3 YEAR EXTENDED WARRANTY MCT2865F3 - JBOSS ENTERPR OPENSHIFT ENTERPR STADD
ICWA3YCC - 3 YEAR EXTENDED WARRANTY MCT2865F3 - JBOSS ENTERPR OPENSHIFT ENTERPR STADD
ICWA3YCA - 3 YEAR EXTENDED WARRANTY MCT2865F3RN - JBOSS ENTERPR OPENSHIFT ENTERPR STADD
ICWA3YCE - 3 YEAR EXTENDED WARRANTY MCT2864F3 - JBOSS ENTERPR OPENSHIFT ENTERPR, PREMIUM
SNAGGSITEMAINT - 3 YEAR MAINTENANCE AGREEMENT 30,000 TO 45,000 USERS MCT2864RN - JBOSS ENTERPR OPENSHIFT ENTERPR, PREMIUM
WOPS3YR10 - 3 YEAR SOFTWARE MAINTENANCE CONTRACT MCT2864F3 - JBOSS ENTERPR OPENSHIFT ENTERPR, PREMIUM
WCHM3YR10 - 3 YEAR SOFTWARE MAINTENANCE CONTRACT MCT2864F3RN - JBOSS ENTERPR OPENSHIFT ENTERPR, PREMIUM
SWMAINT3U-BCU510 - 3 YEAR SOFTWARE MAINTENANCE HOST MCT2748RN - JBOSS ENTERPR OPENSHIFT ENTERPR2 CORE
SWMAINT3U-BCU5U - 3 YEAR SOFTWARE MAINTENANCE HOST MCT2739F3 - JBOSS ENTERPR OPENSHIFT PREMIUM, 2 CORE
SWMAINT3U-BCU10U - 3 YEAR SOFTWARE MAINTENANCE HOST UPGRADE MCT2739F3 - JBOSS ENTERPR OPENSHIFTPREMIUM, 2 CORE
SWMAINT3U-BCAAG - 3 YEAR SOFTWARE MAINTENANCE UPGRADE MCT1350 - JBOSS TECHNICAL ACCOUNT MANAGEMENT SERVICES
SWMAINT3U-BCAMSH - 3 YEAR SOFTWARE MAINTENANCE UPGRADE HYPV 59018 - JPROFILER 1YR SUPPORT AND UPGRADE PACKAG
SWMAINT3U-BCAVM - 3 YEAR SOFTWARE MAINTENANCE UPGRADE VM 59005 - JPROFILER FLOATING LICENSE 1 YR SUPPORT
WMS3YRBASIC - 3 YEAR SOFTWARE SUPPORT CONTRACT 59004 - JPROFILER FLOATING LICENSE WITH 1 YR SUP
WMS3YRVM - 3 YEAR STRUXUREWARE CENTRAL SOFTWARE 59004 - JPROFILER FLOATING LICENSE WITH 1 YR SUP
STM150M3-10000S - 3 YEAR SUPPORT AND MAINTENANCE SUBSCRIPTION, INCLUDES SOFTWARE MAINTENANCE & UPG 59004 - JPROFILER FLOATING LICENSE WITH 1 YR SUP
ICTS3YCA - 3 YEAR TECH SUPPORT LICENSE 59004 - JPROFILER FLOATING LICENSE WITH 1 YR SUP
ICTS3YCD - 3 YEAR TECH SUPPORT LICENSE KASP100-249-3Y - KASPERSKY ANTI-VIRUS UPDATES 100 TO 249 USERS 3 YEAR MAINTENANCE
ICTS3YCB - 3 YEAR TECH SUPPORT LICENSE KASP100-249-3Y - KASPERSKY ANTI-VIRUS UPDATES 100 TO 249 USERS 3 YEAR MAINTENANCE
ICTS3YCC - 3 YEAR TECH SUPPORT LICENSE K30-1112006 - KERIO SOPHOS UPG 5 PACK
ICTS3YCE - 3 YEAR TECH SUPPORT LICENSE K30-1114006 - KERIO SOPHOS UPG 5 PACK EDU
FC-10-0066D-311-02-36 - 3 YEARS 8X5 FORTICARE CONTRACT K30-1113006 - KERIO SOPHOS UPG 5 PACK GOV
SSPG-3 - 3 YEARS ANNUAL SW SUPPORT PLAN K30-1112005 - KERIO SOPHOS UPG SERVER
CF-SVCASCT3Y - 3 YR COMPUTRACE PLUS (CT) K30-1114005 - KERIO SOPHOS UPG SERVER EDU
VIR-SUPP-SC40-3YR-GOLD - 3 YR GOLD SERVERCACHE (ONE SERVER) K30-1113005 - KERIO SOPHOS UPG SERVER GOV
VIR-SUPP-SC40-3YR-PLATINUM - 3 YR PLATINUM SERVERCACHE (ONE SERVER) 906217-02 - KIT,POCKETCLOUD PRO,ANDR-USR,W/MAIN
FBSU3000IM - 3,000,000 IMAGE 920222-78 - KIT,S/W ONLY,WES CONVER,D CLASS
WMS3YR100N - 3-YEAR 100 NODE INFRASTRUXURE CENTRAL SOFTWARE SUPPORT CONTRACT 300047537 - KIWI CATTOOLS - FULL INSTALL - LICENSE W
WMS3YR25N - 3-YEAR 25 NODE INFRASTRUXURE CENTRAL SOFTWARE SUPPORT 300047541 - KIWI CATTOOLS - FULL INSTALL - LICENSE W
902016-14 - 3-YEAR ADVANCE REPLACEMENT MODULAR WINTERM TERMINAL 300048574 - KIWI CATTOOLS - FULL INSTALL 12 MONTH MA
WMS3YRENT - 3-YEAR INFRASTRUXURE CENTRAL ENTERPRISE SOFTWARE SUPPORT CONTRACT 300048928 - KIWI CATTOOLS - FULL INSTALL 24 MONTH MA
WMS3YRSTD - 3-YEAR INFRASTRUXURE CENTRAL STANDARD SOFTWARE SUPPORT CONTRACT 300052008 - KIWI CATTOOLS COMPANY COUNTRY - 12 MONTH
SWMAIN3E-S110 - 3-YEAR SOFTWARE MAINT, 110 300052011 - KIWI CATTOOLS COMPANY COUNTRY - 24 MONTH
SWMAIN3E-S210 - 3-YEAR SOFTWARE MAINT, 210 300048963 - KIWI CATTOOLS COMPANY SITE - 12 MONTH SO
SWMAIN3E-S410 - 3-YEAR SOFTWARE MAINT, 410 300048966 - KIWI CATTOOLS COMPANY SITE - 24 MONTH SO
SWMAIN3E-S520 - 3-YEAR SOFTWARE MAINT, 520 300052042 - KIWI CATTOOLS ENTERPRISE - 12 MONTH SOFT
SWMAIN3E-S620 - 3-YEAR SOFTWARE MAINT, 620 300052045 - KIWI CATTOOLS ENTERPRISE - 24 MONTH SOFT
SWMAIN3E-S650 - 3-YEAR SOFTWARE MAINT, 650 300048975 - KIWI CATTOOLS ENTERPRISE - COUNTRY LICEN
SWMAIN3E-S50 - 3-YEAR SOFTWARE MAINT, S50 300052021 - KIWI CATTOOLS ENTERPRISE - GLOBAL LICENS
730939-16 - 3-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY 300052024 - KIWI CATTOOLS ENTERPRISE - GLOBAL LICENS
730801-15 - 3-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY 300048942 - KIWI CATTOOLS ENTERPRISE - SITE LICENSE
730958-07 - 3-YEAR SOFTWARE MAINTENANCE - RENEWAL ONLY 300048945 - KIWI CATTOOLS ENTERPRISE - SITE LICENSE
5325302146-3 - 3-YEAR SUPPLEMENTAL, EDR, 110 300052097 - KIWI LOG VIEWER (WIN) - SINGLE INSTALL L
5325302148-3 - 3-YEAR SUPPLEMENTAL, EDR, 410 300052132 - KIWI LOG VIEWER - COUNTRY LICENSE (100 M
5325302152-3 - 3-YEAR SUPPLEMENTAL, EDR, 650 300052134 - KIWI LOG VIEWER - COUNTRY MAINTENANCE RE
5325302158-3 - 3-YEAR SUPPLEMENTAL, EDR, UNIX 300052155 - KIWI LOG VIEWER - GLOBAL LICENSE (300 MA
5325302157-3 - 3-YEAR SUPPLEMENTAL, EDR, WIN/LINUX 300052156 - KIWI LOG VIEWER - GLOBAL MAINTENANCE REN
902116-06 - 3-YEAR WARRANTY WITH ADVANCE REPLACEMENT S CLASS 300052096 - KIWI LOG VIEWER - SINGLE INSTALL - LICEN
902116-07 - 3-YEAR WARRANTY WITH ADVANCE REPLACEMENT V CLASS 300052098 - KIWI LOG VIEWER - SINGLE INSTALL MAINTEN
FBSU30CC - 30 CONCURRENT USERS 300052114 - KIWI LOG VIEWER - SITE LICENSE (50 MAX)
7015884-7321-FYM-ENT - 301 TO 500 UNITS FYM ENT SUPRT 300052116 - KIWI LOG VIEWER - SITE MAINTENANCE RENEW
7015884-7308-FYM-ENT - 301 TO 500 UNITS FYM ENT SUPRT 300052115 - KIWI LOG VIEWER -COMPANY SITE LICENSE (5
7015886-7308-FYM-STD - 301 TO 500 UNITS FYM STD SUPRT 300052133 - KIWI LOG VIEWER -COUNTRY LICENSE (100 MA
7015886-7321-FYM-STD - 301 TO 500 UNITS FYM STD SUPRT 300052153 - KIWI LOG VIEWER -GLOBAL LICENSE (300 MAX
PARSONS-32M - 32 MONTH INSTALLMENT MSS FOR PARSONS-ENPOINTE SEPT 2011-APRIL 2014 FOR DEAL ID# 300052072 - KIWI SYSLOG SERVER - COUNTRY INSTALL 12
SVC-SW-3310DM33 - 33MO PPD SUPT SW-DM-3310 300052073 - KIWI SYSLOG SERVER - COUNTRY INSTALL 24
SVC-SW-3510DM33 - 33MO PPD SUPT SW-DM-3510 300052068 - KIWI SYSLOG SERVER - COUNTRY LICENSE (50
SVC-SW-3510DM33 - 33MO PPD SUPT SW-DM-3510 300052069 - KIWI SYSLOG SERVER - COUNTRY LICENSE (50
SVC-SW-6520DM33 - 33MO PPD SUPT SW-DM-6520 300052080 - KIWI SYSLOG SERVER - GLOBAL INSTALL 12 M
SVC-SW-6520DM33 - 33MO PPD SUPT SW-DM-6520 300052081 - KIWI SYSLOG SERVER - GLOBAL INSTALL 24 M
SVC-SW-6720DM33 - 33MO PPD SUPT SW-DM-6720 300052077 - KIWI SYSLOG SERVER - GLOBAL LICENSE (150
SVC-SW-6720DM33 - 33MO PPD SUPT SW-DM-6720 300052076 - KIWI SYSLOG SERVER - GLOBAL LICENSE (150
SVC-SW-3510DMFC33 - 33MO PPD SUPT SW-DMFC-3510 300052052 - KIWI SYSLOG SERVER - SINGLE INSTALL - LI
SVC-SW-3510DMFC33 - 33MO PPD SUPT SW-DMFC-3510 300052053 - KIWI SYSLOG SERVER - SINGLE INSTALL - LI
SVC-SW-6520DMFC33 - 33MO PPD SUPT SW-DMFC-6520 300052056 - KIWI SYSLOG SERVER - SINGLE INSTALL 12 M
SVC-SW-6520DMFC33 - 33MO PPD SUPT SW-DMFC-6520 300052057 - KIWI SYSLOG SERVER - SINGLE INSTALL 24 M
SVC-SW-6720DMFC33 - 33MO PPD SUPT SW-DMFC-6720 300052064 - KIWI SYSLOG SERVER - SITE INSTALL 12 MON
SVC-SW-6720DMFC33 - 33MO PPD SUPT SW-DMFC-6720 300052065 - KIWI SYSLOG SERVER - SITE INSTALL 24 MON
SVC-SW-3310DMFC33 - 33MO PPD SUPT SW-DMFC3310 300052060 - KIWI SYSLOG SERVER - SITE LICENSE (25 MA
SVC-SW-3310DRSTR33 - 33MO PPD SUPT SW-DRSTR-3310 300052061 - KIWI SYSLOG SERVER - SITE LICENSE (25 MA
SVC-SW-3310DRSTR33 - 33MO PPD SUPT SW-DRSTR-3310 KRMC-CLOUD - KRMC CLOUD 1 YR SUBSCRIPTION
SVC-SW-3510DRSTR33 - 33MO PPD SUPT SW-DRSTR-3510 KRMC-CLOUD-PRO - KRMC CLOUD PRO - ACCOUNT UPGRADE 1 YEAR
SVC-SW-3510DRSTR33 - 33MO PPD SUPT SW-DRSTR-3510 PRP-LAB-SMAINT - LAB SYSTEM,INCLUDES 1000 DEV-ANNUAL S
SVC-SW-6520DRSTR33 - 33MO PPD SUPT SW-DRSTR-6520 4ZK0A39587 - LANDESK CREDANT TECH 100 DEVICES MNT
SVC-SW-6520DRSTR33 - 33MO PPD SUPT SW-DRSTR-6520 4ZK0A39588 - LANDESK CREDANT TECH CMG ENTERPRISE (MNT)
SVC-SW-6720DRSTR33 - 33MO PPD SUPT SW-DRSTR-6720 4ZN0A23874 - LANDESK CREDANT TECH CMG ENTERPRISE (PER DEVICE)
SVC-SW-6720DRSTR33 - 33MO PPD SUPT SW-DRSTR-6720 4ZN0A23873 - LANDESK CREDANT TECH CMG SRVR(UP TO 100 DEVICES)
SVC-SW-3510GN33 - 33MO PPD SUPT SW-GN-3510 55Y2479 - LANDESK LDALMSPN
SVC-SW-3510GN33 - 33MO PPD SUPT SW-GN-3510 4ZK0E82588 - LANDESK MANAGEMENT SUITE MAINTENANCE FOR LENOVO TVT 500-999
SVC-SW-6520GN33 - 33MO PPD SUPT SW-GN-6520 4ZK0E82589 - LANDESK MANAGEMENT SUITE MAINTENANCE FOR LENOVO TVT 500-999
SVC-SW-6520GN33 - 33MO PPD SUPT SW-GN-6520 4ZK0E82590 - LANDESK MANAGEMENT SUITE MAINTENANCE FOR LENOVO TVT 500-999
SVC-SW-6720GN33 - 33MO PPD SUPT SW-GN-6720 CF-S09LNXSPT3YL - LAR SPECIFIC - LINUX SUPPORT FROM SVC PROVIDER - YEARS (1,2 & 3) MINIMUM QUANTIT
SVC-SW-6720GN33 - 33MO PPD SUPT SW-GN-6720 CF-S09LNXSPT4YL - LAR SPECIFIC - LINUX SUPPORT FROM SVC PROVIDER - YEARS (1,2,3 & 4) MINIMUM QUANT
SVC-SW-3310GN33 - 33MO PPD SUPT SW-GN3310 CF-S09LNXSPT5YL - LAR SPECIFIC - LINUX SUPPORT FROM SVC PROVIDER - YEARS (1,2,3,4 & 5) MINIMUM QUA
SVC-SW-3310GN33 - 33MO PPD SUPT SW-GN3310 WG019932 - LARGE OFFICE 1-YR DATA LOSS PREVENTION
SVC-SW-3510HA33 - 33MO PPD SUPT SW-HA-3510 WG019936 - LARGE OFFICE 3-YR DATA LOSS PREVENTION
SVC-SW-3510HA33 - 33MO PPD SUPT SW-HA-3510 30R6042 - LD SYSTEM MGR 3 PMA
SVC-SW-3310NDMP33 - 33MO PPD SUPT SW-NDMP-3310 30R5976 - LDPM 1-999 STD PMA
SVC-SW-3310NDMP33 - 33MO PPD SUPT SW-NDMP-3310 6641 - LEGACY DAMEWARE PATCH MANAGER DPM100 (UP
SVC-SW-3510NDMP33 - 33MO PPD SUPT SW-NDMP-3510 11295 - LEGACY SOLARWINDS PATCH MANAGER PM100 (U
SVC-SW-3510NDMP33 - 33MO PPD SUPT SW-NDMP-3510 11298 - LEGACY SOLARWINDS PATCH MANAGER PM1000 (
SVC-SW-6720NDMP33 - 33MO PPD SUPT SW-NDMP-6520 11304 - LEGACY SOLARWINDS PATCH MANAGER PM10500
SVC-SW-6520NDMP33 - 33MO PPD SUPT SW-NDMP-6520 11311 - LEGACY SOLARWINDS PATCH MANAGER PM110000
SVC-SW-6520NDMP33 - 33MO PPD SUPT SW-NDMP-6520 11312 - LEGACY SOLARWINDS PATCH MANAGER PM130000
SVC-SW-6720NDMP33 - 33MO PPD SUPT SW-NDMP-6520 11305 - LEGACY SOLARWINDS PATCH MANAGER PM14000
FBSU35CC - 35 CONCURRENT USERS 11299 - LEGACY SOLARWINDS PATCH MANAGER PM1500 (
90000-AP3-BFMC - 3RD YEAR M&S 11313 - LEGACY SOLARWINDS PATCH MANAGER PM150000
LIC-ENT-3YR-SG - 3YR LIC AND SUP MR ENTERPRISE 11300 - LEGACY SOLARWINDS PATCH MANAGER PM2000 (
730957-03 - 3YR MAINT & SUP SYGATE AGENT AFTER INIT AGR EXP 11306 - LEGACY SOLARWINDS PATCH MANAGER PM20000
NVR-04SGR - 4 CHANNEL SOFTWARE LICENSE FOR ENVS 11314 - LEGACY SOLARWINDS PATCH MANAGER PM200000
CPTS-PRO-4D-JS - 4 DAYS JUMP START POINTSEC FOR PC LEGACY 11296 - LEGACY SOLARWINDS PATCH MANAGER PM250 (U
Y4XPCOBT-S - 4 Y PMA FOR XPROT CORP BSSVR -S 11307 - LEGACY SOLARWINDS PATCH MANAGER PM30000
Y4XPPBL-P - 4 Y PMA FOR XPROT PRO BSLIC -P 11315 - LEGACY SOLARWINDS PATCH MANAGER PM300000
Y4XPPBL-S - 4 Y PMA FOR XPROT PRO BSLIC -S 11301 - LEGACY SOLARWINDS PATCH MANAGER PM4000 (
Y4XPSWBL-S - 4 Y PMA FOR XPROT SMTWLL BSLIC -S 11308 - LEGACY SOLARWINDS PATCH MANAGER PM40000
ABMDSTCN-TOSH4 - 4 YEAR ABSOLUTE MANAGE 11297 - LEGACY SOLARWINDS PATCH MANAGER PM500 (U
LJP-RE-P5-WIN-48 - 4 YEAR PREMIUM 11302 - LEGACY SOLARWINDS PATCH MANAGER PM5500 (
CF-SVCASCTC4Y - 4 YR COMPUTRACE COMPLETE (CTC) 11309 - LEGACY SOLARWINDS PATCH MANAGER PM60000
CF-SVCASCDP4Y - 4 YR COMPUTRACE DATA PROTECTION (CDP) 11303 - LEGACY SOLARWINDS PATCH MANAGER PM8000 (
ASR5002 - 4-10 DOCTORS FOR FIREWALL, IPS, WCF, WEB 11310 - LEGACY SOLARWINDS PATCH MANAGER PM80000
FBSU40CC - 40 CONCURRENT USERS 40Y7961 - LENOVO LANDESK DEPLOYMENT SERVICES LDMS FOR TVT PMA 1YR AUTHO REQIND LANDESK MS
4L40D84567 - 40-WI-OLN: WEB-BASED INSTALLATION AND CONSULTING - PER 8 HOURS (1 DAY) 30R6160 - LENOVO LANDESK DESKTOP OPTIONS PROFESSIONAL SERVICES
FBSU45CC - 45 CONCURRENT USERS 30R6161 - LENOVO LANDESK DESKTOP OPTIONS TRAVEL & EXPENSES
SWS-SOTIMC-50 - 5 YEAR SOFTWARE SUPPORT FOR SOTI CR-SWIFT-F1 - LICENSE FOR CONVERSION
FBSUWFX - 5 CONCURRENT 100K WORKFLOW SOFTWARE 4L40A12406 - LICENSEKEY CLDSRADDON
FBSU5CC - 5 CONCURRENT USERS 4L40A12405 - LICENSEKEY CLDSRVSTR
CPTS-PRO-5D-JS - 5 DAYS JUMP START PACKAGE TO BE USED WIT 65233392BA02A10 - LICENSING SUBSCRIPTION RENEWAL MONTHLY
AQTC5-CS - 5 USER TOUCHCHART 3000-0000-0009 - LIFESIZE CLOUD 100 RENEWAL - UP TO 100
AQTC5-M - 5 USER TOUCHCHART MAINTENANCE 1000-21S0-1101 - LIFESIZE ROOM - PARTNER ASSURANC
Y5XPCOBT-S - 5 Y PMA FOR XPROT CORP BSSVR -S 1000-21S0-1113 - LIFESIZE ROOM 200 - PARTNER ASSURANCE
Y5XPSWBL-S - 5 Y PMA FOR XPROT SMTWLL BSLIC -S 1000-21S0-1107 - LIFESIZE TEAM MP - PARTNER ASSURANCE
CF-SVCASCT5Y - 5 YR COMPUTRACE PLUS (CT) LX295-2503W-5.0.7V - LIFETIME SUBSCRIPTION RENEWAL FROM 3YR
VIR-SUPP-SC40-5YR-GOLD - 5 YR GOLD SERVERCACHE (ONE SERVER) LIKEWISE-12X5-SU-24M-SER - LIKEWISE ENT 12X5 SPT AND UPDATES, 2-YR
VIR-SUPP-SC40-5YR-PLATINUM - 5 YR PLATINUM SERVERCACHE (ONE SERVER) MCT1963F3RN - LINUX EXTENDED LIFE CYCLE
FBSU5000IM - 5,000,000 IMAGE MCT1963F3 - LINUX EXTENDED LIFE CYCLE
902116-01 - 5-YEAR WARRANTY WITH ADVANCE REPLACEMENT S CLASS MCT1965RN - LINUX EXTENDLIFECYCLE F ITANIUM (IA64)
902116-02 - 5-YEAR WARRANTY WITH ADVANCE REPLACEMENT V CLASS MCT1965F3RN - LINUX EXTENDLIFECYCLE F ITANIUM (IA64)
FBSU50CC - 50 CONCURRENT USERS MCT1965F3 - LINUX EXTENDLIFECYCLE F ITANIUM (IA64)
BW-50-STBY-SUPP - 50 USER LICENSE CF-S09LNXSPT4Y - LINUX SUPPORT
FBSU50IM - 50,000 IMAGE CF-S09LNXSPT5Y - LINUX SUPPORT
ABM-GDED50MTC-36 - 50,000 PLUS 3 YEARABSOLUTE MANAGE MAINTE CF-S09LNXSPT3Y - LINUX SUPPORT
FBSU500IM - 500,000 IMAGE WB5505 - LINUX SYSTEM ADMINISTRATION: STRATUS
7015884-7322-FYM-ENT - 501 TO 750 UNITS FYM ENT SUPRT WG017189 - LIVESECURITY SERVICE REINSTATEMENT - ALL FIREBOX X EDGE MODELS
7015884-7309-FYM-ENT - 501 TO 750 UNITS FYM ENT SUPRT GEN0113 - LMS CUSTOM SHU FOR LDI GENPACT 0113 CPP
7015886-7322-FYM-STD - 501 TO 750 UNITS FYM STD SUPRT INV167781 - LMS CUSTOM SKU BREEZEIT DAN BISTANY 12HRS 3/11/13-3/17/13
7015886-7309-FYM-STD - 501 TO 750 UNITS FYM STD SUPRT WHAL210213 - LMS CUSTOM SKU FOR WHALLEY 21 CPP 0213
7015884-7316-FYM-ENT - 51 TO 100 UNITS FYM ENT SUPRT INV167782 - LMS CUSTOM SKU MERCOM/ETL SPECIALIST 32HRS 3/4/13-3/10/13
7015884-7303-FYM-ENT - 51 TO 100 UNITS FYM ENT SUPRT INV167783 - LMS CUSTOM SKU MERCOM/ETL SPECIALIST 40HRS 3/11/13-3/17/13
7015886-7303-FYM-STD - 51 TO 100 UNITS FYM STD SUPRT RGTCLCK - LMS RIGHT CLICK OFFICE
7015886-7316-FYM-STD - 51 TO 100 UNITS FYM STD SUPRT WKSINTER0213 - LMS SKU FOR WEEKS INTERNAL 0213 CPP
90033-AP5 - 5TH YEAR PREPAID M&S WHALHAMP0213 - LMS SKU FOR WHALLEY HAMPDEN CPP 0213
UPSG64TB - 64TB NS LICENSE UPGRADE SILVER TO GOLD 415655.1 - LMS-415655.1
SVC-DSC-BER-STD - 6FUSION DATA SEED CHRG, BERMUDA DTACNTER 415661 - LMS-415661
SVC-DSC-LIT-STD - 6FUSION DTASEED CHRG LITTLETON MASS USA 416784 - LMS-416784
UC6-WAC-BER-STD - 6FUSION PUBLIC CLOUD PRICE PER KWAC. BERMUDA DATACENTER 417401 - LMS-417401
UC6-WAC-CGY-STD - 6FUSION PUBLIC CLOUD PRICE PER KWAC. CALGARY, ALBERTA, CANADA DATACENTER 417970 - LMS-417970
UC6-WAC-LVN-STD - 6FUSION PUBLIC CLOUD PRICE PER KWAC. LAS VEGAS NV, USA DATACENTER 418899 - LMS-418899
UC6-WAC-LIT-STD - 6FUSION PUBLIC CLOUD PRICE PER KWAC. LITTLETON MASS, USA DATACENTER 419426 - LMS-419426
UC6-WAC-TOR-STD - 6FUSION PUBLIC CLOUD PRICE PER KWAC. TORONTO, ONTARIO, CANADA DATACENTER 419517 - LMS-419517
SVC-DSC-CGY-STD - 6FUSIONDTSEEDCHRG CALGARY ALBERTA CANADA 419802 - LMS-419802
SVC-DSC-TOR-STD - 6FUSIONDTSEEDCHRG TORONTO ONTARIO CANADA 419859 - LMS-419859
RB-SUP724-10 - 724 10 CALL PACKAGE MUST INCLUDE RB-SUP724 420181 - LMS-420181
RB-SUP724-5 - 724 5 CALL PACKAGE MUST INCLUDE RB-SUP724 420356 - LMS-420356
RB-SUP724 - 724 OPTION IN ADDITION TO ANNUAL SUPPORT AND MAINTENANCE 421147 - LMS-421147
7015884-7323-FYM-ENT - 751 TO 1000 UNITS FYM ENT SUPRT 421309 - LMS-421309
7015884-7310-FYM-ENT - 751 TO 1000 UNITS FYM ENT SUPRT 421483 - LMS-421483
7015886-7323-FYM-STD - 751 TO 1000 UNITS FYM STD SUPRT 421629 - LMS-421629
7015886-7310-FYM-STD - 751 TO 1000 UNITS FYM STD SUPRT 421788 - LMS-421788
GFI951-14-54 - 8 CHANNEL FOIP SOFTWARE FOR DISASTER RECOVERY 421886 - LMS-421886
SVC-SW-3310DM9 - 9 MO PPD SUPT SW-DM-3310 422176 - LMS-422176
SVC-SW-3510DM9 - 9 MO PPD SUPT SW-DM-3510 422331 - LMS-422331
SVC-SW-6520DM9 - 9 MO PPD SUPT SW-DM-6520 422432 - LMS-422432
SVC-SW-6720DM9 - 9 MO PPD SUPT SW-DM-6720 422809 - LMS-422809
SVC-SW-3510DMFC9 - 9 MO PPD SUPT SW-DMFC-3510 WG017109 - LS CORE REINSTATEMENT FEE
SVC-SW-3510DMFC9 - 9 MO PPD SUPT SW-DMFC-3510 DCEMC-1YR-250 - LUMENSION DEVICE CONTROL ENTERPRISE MAINTENANCE CLASSIC
SVC-SW-6520DMFC9 - 9 MO PPD SUPT SW-DMFC-6520 LEMSSSTDM-1YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6520DMFC9 - 9 MO PPD SUPT SW-DMFC-6520 LEMSSSTDM-3YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6720DMFC9 - 9 MO PPD SUPT SW-DMFC-6720 LEMSSSTDM-3YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6720DMFC9 - 9 MO PPD SUPT SW-DMFC-6720 LEMSSSTDS-1YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3310DMFC9 - 9 MO PPD SUPT SW-DMFC3310 LEMSSSTDS-2YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3310DMFC9 - 9 MO PPD SUPT SW-DMFC3310 LEMSSSTDS-3YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3310DRST9 - 9 MO PPD SUPT SW-DRSTR-3310 LEMSSENTM-2YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3310DRST9 - 9 MO PPD SUPT SW-DRSTR-3310 LEMSSSTDM-2YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3510DRST9 - 9 MO PPD SUPT SW-DRSTR-3510 LEMSSENTM-3YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3510DRST9 - 9 MO PPD SUPT SW-DRSTR-3510 LEMSSSTDM-2YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6520DRST9 - 9 MO PPD SUPT SW-DRSTR-6520 LEMSSSTDS-2YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6520DRST9 - 9 MO PPD SUPT SW-DRSTR-6520 LEMSSENTM-1YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6720DRST9 - 9 MO PPD SUPT SW-DRSTR-6720 LEMSSENTS-1YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6720DRST9 - 9 MO PPD SUPT SW-DRSTR-6720 LEMSSENTS-2YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3510GN9 - 9 MO PPD SUPT SW-GN-3510 LEMSSSTDS-1YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6520GN9 - 9 MO PPD SUPT SW-GN-6520 LEMSSSTDM-1YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6720GN9 - 9 MO PPD SUPT SW-GN-6720 LEMSSSTDS-3YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3310GN9 - 9 MO PPD SUPT SW-GN3310 LEMSSENTM-3YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3310HA9 - 9 MO PPD SUPT SW-HA-3310 LEMSSENTM-3YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3510HA9 - 9 MO PPD SUPT SW-HA-3510 LEMSSENTM-1YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3310NDMP9 - 9 MO PPD SUPT SW-NDMP-3310 LEMSSENTS-3YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3310NDMP9 - 9 MO PPD SUPT SW-NDMP-3310 LEMSSENTS-3YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3510NDMP9 - 9 MO PPD SUPT SW-NDMP-3510 LEMSSSTDS-3YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-3510NDMP9 - 9 MO PPD SUPT SW-NDMP-3510 LEMSSENTS-1YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6520NDMP9 - 9 MO PPD SUPT SW-NDMP-6520 LEMSSENTS-2YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6520NDMP9 - 9 MO PPD SUPT SW-NDMP-6520 LEMSSENTS-2YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6720NDMP9 - 9 MO PPD SUPT SW-NDMP-6720 LEMSSSTDM-1YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SVC-SW-6720NDMP9 - 9 MO PPD SUPT SW-NDMP-6720 LEMSSSTDS-1YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
EWXNOW1E-BCA2 - 9 MONTH - SOFTWARE MAINTENANCE UPGRADE LEMSSENTM-2YR-10000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SWMAINT1U-BCA1 - 9 MONTH - SOFTWARE MAINTENANCE UPGRADE LEMSSENTS-1YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SWMAINT1U-BCU10U - 9 MONTH SOFTWARE MAINTENANCE HOST LEMSSENTS-3YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SWMAINT1U-BCU5U - 9 MONTH SOFTWARE MAINTENANCE HOST LEMSSSTDM-2YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SWMAINT1U-BCU510 - 9 MONTH SOFTWARE MAINTENANCE HOST LEMSSSTDM-3YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SWMAINT1U-BCAAG - 9 MONTH SOFTWARE MAINTENANCE UPGRADE LEMSSSTDS-2YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SWMAINT1U-BCAVM - 9 MONTH SOFTWARE MAINTENANCE UPGRADE VM LEMSSENTM-1YR-5000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
SWMAINT1U-BCAMSH - 9 MONTH SOFTWARE MAINTENANCE UPGRADEHYPV LEMSSENTM-2YR-1000+ - LUMENSION ENDPOINT MGMT AND SECURITY SUI
CPTS-PRO-PJM - A PROJECT MANAGER WILL BE ENGAGED AND AS 40Y8014 - LVO AUTH REQ LDMS F/TVT
ABM-GD-GS-MTC-09 - ABM FEDERAL DHHS-NIH-NIMH MAINTENANCE ONLY 40Y7969 - LVO LANDESK SEC STE AUTH REQ ADDON
ABM-GDOC-MTNC-36 - ABM MAINTENANCE 3YRS ORANGE COUNTY PS ONLY 7AH-00437 - LYNC SERVER ENT CAL ALL LNG LICENSE/SFT
7015884-7325-FYM-ENT - ABOVE 1500 UNITS FYM ENT SUPRT 7AH-00439 - LYNC SERVER ENT CAL ALL LNG LICENSE/SFT
7015884-7312-FYM-ENT - ABOVE 1500 UNITS FYM ENT SUPRT 90001-C01-CLAY - M&S CATCH UP FEE (11/09 TO 7/10)
7015886-7312-FYM-STD - ABOVE 1500 UNITS FYM STD SUPRT MCQLTR.4.M&S - MAINTENANCE & SUPPORT-CALCULATED AT 20%
7015886-7325-FYM-STD - ABOVE 1500 UNITS FYM STD SUPRT SNAGG12499REN - MAINTENANCE RENEWAL FOR SNAGIT
PS-GD-CIS - ABSOLUTE COMPUTRACE INVESTIGATIVE SERVICES MPS12A500 - MALWAREBYTES BUSINESS SUPPORT: TIER 3 COMPREHENSIVE SUPPORT FOR YOUR BUSINESS
PS-GD-CIS-GSA - ABSOLUTE COMPUTRACE INVESTIGATIVE SERVICES GSA ONLY I-554-2590 - MANAGED FILE INTEGRITY MONITORING
ABMGDEDU9999MTNC - ABSOLUTE MANAGE MAINT ED I-550-2591 - MANAGED FILE INTEGRITY MONITORING
AMMD-GDEDMNTC-36 - ABSOLUTE MANAGE MAINT. I-553-2590 - MANAGED FILE INTEGRITY MONITORING
ABM-GD-JH-MTC-06 - ABSOLUTE MANAGE MAINTENANCE I-551-2590 - MANAGED FILE INTEGRITY MONITORING
ABM-GD-RI-MTC-05 - ABSOLUTE MANAGE MAINTENANCE BUYBACK SKU FOR ROUNDARCH ONLY I-552-2590 - MANAGED FILE INTEGRITY MONITORING
ABM-GD-MGHDR-25 - ABSOLUTE MANAGE MASSACHUSETTS GENERAL HOSPITAL 25 MONTH SKU ONLY I-550-2531 - MANAGED FILE INTEGRITY MONITORING
AMMD2-GD-12 - ABSOLUTE MANAGE MDM HOSTED TO ABSOLUTE MANAGE MDM CLOUD 1YR I-553-2506 - MANAGED FILE INTEGRITY MONITORING
AMMD2-GD-36 - ABSOLUTE MANAGE MDM HOSTED TO ABSOLUTE MANAGE MDM CLOUD 3YR I-554-2506 - MANAGED FILE INTEGRITY MONITORING
AMMD-GD-G-MTC-13 - ABSOLUTE MANAGE MDM 13 MONTH SKU FOR GRESHAM BARLOW ONLY I-550-2590 - MANAGED FILE INTEGRITY MONITORING
AMMD-GD-ECF-MTNC - ABSOLUTE MANAGE MDM ETHICAL CULTURE SCHOOL MAINTENANCE S-264-2597 - MANAGED FILE INTEGRITY MONITORING
KIT-AMMD-GD-K-12 - ABSOLUTE MANAGE MDM NODE + MTC BUNDLE FOR KELLY SERVICES ONLY. 21288790 - MANAGED PKI SUPPT GOLD ACD A 12MO
KIT-AMMD-GD-S-12 - ABSOLUTE MANAGE MDM STRAIGHT TO MTC FOR KELLY SERVICES ONLY 1 YR. 21289060 - MANAGED PKI SUPPT GOLD ACD A 24MO
ABM-GDEDCB2-MTNC - ABSOLUTE MANAGE STRAIGHT TO MAINTENANCE RENEWAL ONLY. 21289332 - MANAGED PKI SUPPT GOLD ACD A 36MO
ABSES-GD-OSI-MTC - ABSOLUTE SERVICE (3 ROLES) MAINTENANCE FOR OSI ONLY 21288809 - MANAGED PKI SUPPT GOLD ACD H 12MO
KIT-GD-ABSEP-TI - ABSOLUTE SERVICE (5 ROLES) MAINTENANCE TMI HOSPITALITY ONLY 21289038 - MANAGED PKI SUPPT GOLD ACD H 24MO
ABSES-GD-OSI-12 - ABSOLUTE SERVICE FOR OSI LABS 1YR ONLY 21288788 - MANAGED PKI SUPPT GOLD ACD H 36MO
4ZK0D80482 - ABSOLUTE SERVICES ABSOLUTE SOT-D-CT-CREDIT 21288565 - MANAGED PKI SUPPT GOLD EXP A 12MO
ABTR-D-TVA-26 - ABSOLUTE TRACK 26 MONTH, FEDERAL, TERM 21289316 - MANAGED PKI SUPPT GOLD EXP A 24MO
901166 - ACCESSDATA ENTERPRISE TRAVEL BUNDLE 21289186 - MANAGED PKI SUPPT GOLD EXP A 36MO
146.AB769.003 - ACERPOWER F2&SV NEXT-BUS-DAY LIMITED ON-SITE SERVICE FOR 3 YEARS-NON-RETURN 21288812 - MANAGED PKI SUPPT GOLD EXP B 12MO
65234080BA01A12 - ACROBAT PRO SUBSCRIPTION 5 MONTH 21288658 - MANAGED PKI SUPPT GOLD EXP B 24MO
65234098BA01A12 - ACROBAT STD SUBSCRIPTION 5 MONTH 21289305 - MANAGED PKI SUPPT GOLD EXP B 36MO
ACTPRO2012MP - ACT GOLD FOR PRO 1YR 21288919 - MANAGED PKI SUPPT GOLD EXP C 12MO
ACTPRM2012MP - ACT GOLD FOR PRO 1YR 21288732 - MANAGED PKI SUPPT GOLD EXP C 24MO
ACTPRM2013MP - ACT GOLD FOR PRO 1YR 21289207 - MANAGED PKI SUPPT GOLD EXP C 36MO
ACTPRO2013MP - ACT GOLD FOR PRO 1YR 21289093 - MANAGED PKI SUPPT GOLD EXP D 12MO
ACC62CWP - ACTIVCLIENT 6.2 CAC INSTALL 21289183 - MANAGED PKI SUPPT GOLD EXP D 24MO
7015471-7017623-ENT - ACTIVE MESSAGING FYM ENT SUPRT 21289101 - MANAGED PKI SUPPT GOLD EXP D 36MO
7015470-7017623-STD - ACTIVE MESSAGING FYM STD SUPRT 21288946 - MANAGED PKI SUPPT GOLD EXP E 12MO
WB0095 - ACTIVESERVICE MANAGER USER INTERFACE 21288986 - MANAGED PKI SUPPT GOLD EXP E 24MO
0A35091 - ADD 2ND YR. SD ENT. SILVER ED. MULTI-PLATFORM SUPPORT (1,000 - 4,999 SEATS) 21289161 - MANAGED PKI SUPPT GOLD EXP E 36MO
0A35104 - ADD 3RD YR. SD ENT. SILVER ED. MULTI-PLATFORM SUPPORT (1,000 - 4,999 SEATS) 21288764 - MANAGED PKI SUPPT GOLD EXP F 12MO
AQTC-VPM-CS - ADDITIONAL AQ PRINT VIRTUAL PRINTER LICENSES 21289141 - MANAGED PKI SUPPT GOLD EXP F 24MO
AQTC-VP-CS - ADDITIONAL AQ PRINT VIRTUAL PRINTER LICENSES W 1ST. YRS. MAINT. 21289137 - MANAGED PKI SUPPT GOLD EXP F 36MO
AQEMRAD-M - ADDITIONAL EMR PROVIDERS MAINTENANCE 21288738 - MANAGED PKI SUPPT GOLD GOV A 12MO
CPTS-PRO-EPS-ADD - ADDITIONAL ENDPOINT BLADE INSTALLATION ( 21288743 - MANAGED PKI SUPPT GOLD GOV A 24MO
CPTS-PRO-ADD-ATAM1 - ADDITIONAL ON-SITE TAM DAYS 21288698 - MANAGED PKI SUPPT GOLD GOV A 36MO
SZMWESMT1YR - ADDITIONAL ONE YEAR MAINTENANCE 21289130 - MANAGED PKI SUPPT GOLD GOV H 12MO
EXT-DS-TRAINING-02 - ADDITIONAL PER/HOUR TO WEB TRAINING 21288623 - MANAGED PKI SUPPT GOLD GOV H 24MO
RB-AREP - ADDITIONAL REPLICATION (EACH ADDTNL) 21288702 - MANAGED PKI SUPPT GOLD GOV H 36MO
AQTC-AS-CS - ADDITIONAL SCAN LICENSE 21289029 - MANAGED PKI SUPPT PLAT ACD A 12MO
AQTCAU-CS - ADDITIONAL TOUCHCHART USERS 21289255 - MANAGED PKI SUPPT PLAT ACD A 24MO
AQTCAU-M - ADDITIONAL TOUCHCHART USERS MAINTENANCE 21288785 - MANAGED PKI SUPPT PLAT ACD A 36MO
LC2010 - ADREM LITECON 2010 SIRE LICENSE 1 YEAR SA 21288810 - MANAGED PKI SUPPT PLAT ACD H 12MO
902116-83 - ADV EXCHANGE SVC AIO 3YR 21289235 - MANAGED PKI SUPPT PLAT ACD H 24MO
902116-84 - ADV EXCHANGE SVS AIO 1YR EXT 21289222 - MANAGED PKI SUPPT PLAT ACD H 36MO
902116-85 - ADV EXCHANGE SVS AIO 2YR EXT 21288566 - MANAGED PKI SUPPT PLAT EXP A 12MO
BAT11R1EC - ADVANCE TAPE SUPPORT W/ASM, V11 MAC 21288730 - MANAGED PKI SUPPT PLAT EXP A 24MO
BAT11U1EC - ADVANCE TAPE SUPPORT W/ASM, V11 MAC 21289324 - MANAGED PKI SUPPT PLAT EXP A 36MO
7015471-7017634-ENT - ADVANCED EDITION (CHIP) FYM ENT SUPRT 21289044 - MANAGED PKI SUPPT PLAT EXP B 12MO
7015470-7017634-STD - ADVANCED EDITION (CHIP) FYM STD SUPRT 21288659 - MANAGED PKI SUPPT PLAT EXP B 24MO
7015471-7017633-ENT - ADVANCED EDITION (USER) FYM ENT SUPRT 21288689 - MANAGED PKI SUPPT PLAT EXP B 36MO
7015470-7017633-STD - ADVANCED EDITION (USER) FYM STD SUPRT 21289121 - MANAGED PKI SUPPT PLAT EXP C 12MO
7015471-7017604-ENT - ADVANCED SECURITY OPTION FYM ENT SUPRT 21288733 - MANAGED PKI SUPPT PLAT EXP C 24MO
7015470-7017604-STD - ADVANCED SECURITY OPTION FYM STD SUPRT 21288646 - MANAGED PKI SUPPT PLAT EXP C 36MO
BDD09R1EN - ADVANCED TAPE SUPPORT, V9 WIN 21289274 - MANAGED PKI SUPPT PLAT EXP D 12MO
CPTS-PRO-ATAM1 - ADVANCED TECHNICAL ACCOUNT MANAGEMENT 21289323 - MANAGED PKI SUPPT PLAT EXP D 24MO
21210972-26A-A-60 - ADVISORMAI ON SYMANTEC.CLOUD BAND A 60 MONTHS PAID UPFRONT 21289294 - MANAGED PKI SUPPT PLAT EXP D 36MO
21210990-26A-A-12 - ADVISORMAIL BLOOMBERG ON BAND A 12MO 21288947 - MANAGED PKI SUPPT PLAT EXP E 12MO
21210990-26A-A-24-Y1 - ADVISORMAIL BLOOMBERG ON BAND A 24MO Y1 21289184 - MANAGED PKI SUPPT PLAT EXP E 24MO
21210990-26A-A-24-Y2 - ADVISORMAIL BLOOMBERG ON BAND A 24MO Y2 21288716 - MANAGED PKI SUPPT PLAT EXP E 36MO
21210990-26A-A-36-Y1 - ADVISORMAIL BLOOMBERG ON BAND A 36MO Y1 21289012 - MANAGED PKI SUPPT PLAT EXP F 12MO
21210990-26A-A-36-Y2 - ADVISORMAIL BLOOMBERG ON BAND A 36MO Y2 21289142 - MANAGED PKI SUPPT PLAT EXP F 24MO
21210990-26A-A-36-Y3 - ADVISORMAIL BLOOMBERG ON BAND A 36MO Y3 21289138 - MANAGED PKI SUPPT PLAT EXP F 36MO
21210990-26A-B-12 - ADVISORMAIL BLOOMBERG ON BAND B 12MO 21288995 - MANAGED PKI SUPPT PLAT GOV A 12MO
21210990-26A-B-24-Y1 - ADVISORMAIL BLOOMBERG ON BAND B 24MO Y1 21288998 - MANAGED PKI SUPPT PLAT GOV A 24MO
21210990-26A-B-24-Y2 - ADVISORMAIL BLOOMBERG ON BAND B 24MO Y2 21288699 - MANAGED PKI SUPPT PLAT GOV A 36MO
21210990-26A-B-36-Y1 - ADVISORMAIL BLOOMBERG ON BAND B 36MO Y1 21289300 - MANAGED PKI SUPPT PLAT GOV H 12MO
21210990-26A-B-36-Y2 - ADVISORMAIL BLOOMBERG ON BAND B 36MO Y2 21288624 - MANAGED PKI SUPPT PLAT GOV H 24MO
21210990-26A-B-36-Y3 - ADVISORMAIL BLOOMBERG ON BAND B 36MO Y3 21288972 - MANAGED PKI SUPPT PLAT GOV H 36MO
21210990-26A-C-12 - ADVISORMAIL BLOOMBERG ON BAND C 12MO 7008441-7017721-ENT - MANAGEMENT NUL ADD-ON FYM ENT SUPRT
21210990-26A-C-24-Y1 - ADVISORMAIL BLOOMBERG ON BAND C 24MO Y1 7010282-7017721-STD - MANAGEMENT NUL ADD-ON FYM STD SUPRT
21210990-26A-C-24-Y2 - ADVISORMAIL BLOOMBERG ON BAND C 24MO Y2 MG-GPS-MW - MANAGEMENT SERVICES FOR MIDDLEWARE
21210990-26A-C-36-Y1 - ADVISORMAIL BLOOMBERG ON BAND C 36MO Y1 MG-GPS-RH - MANAGEMENT SERVICES FOR RHN
21210990-26A-C-36-Y2 - ADVISORMAIL BLOOMBERG ON BAND C 36MO Y2 WCPS-CON1H - MANAGEMENT SYSTEMS &SOFTWARE CONSULTING
21210990-26A-C-36-Y3 - ADVISORMAIL BLOOMBERG ON BAND C 36MO Y3 4L40E68404 - MDM 2K MAINTENANCE
21210990-26A-D-12 - ADVISORMAIL BLOOMBERG ON BAND D 12MO PS-MDM-TRCNY - MDM PS INSTALLATION SERVICES
21210990-26A-D-24-Y1 - ADVISORMAIL BLOOMBERG ON BAND D 24MO Y1 MCMSD11USC02 - MEDIA SUITE DELUXE MAINTENANCE
21210990-26A-D-24-Y2 - ADVISORMAIL BLOOMBERG ON BAND D 24MO Y2 MCMSD11USC03 - MEDIA SUITE DELUXE MAINTENANCE
21210990-26A-D-36-Y1 - ADVISORMAIL BLOOMBERG ON BAND D 36MO Y1 MCMSD11USC04 - MEDIA SUITE DELUXE MAINTENANCE
21210990-26A-D-36-Y2 - ADVISORMAIL BLOOMBERG ON BAND D 36MO Y2 MCMSD11USC01 - MEDIA SUITE DELUXE MAINTENANCE
21210990-26A-D-36-Y3 - ADVISORMAIL BLOOMBERG ON BAND D 36MO Y3 MCMSUL11USC03 - MEDIA SUITE ULTIMATE MAINTENANCE
21210990-26A-E-12 - ADVISORMAIL BLOOMBERG ON BAND E 12MO MCMSUL11USC04 - MEDIA SUITE ULTIMATE MAINTENANCE
21210990-26A-E-24-Y1 - ADVISORMAIL BLOOMBERG ON BAND E 24MO Y1 MCMSUL11USC01 - MEDIA SUITE ULTIMATE MAINTENANCE
21210990-26A-E-24-Y2 - ADVISORMAIL BLOOMBERG ON BAND E 24MO Y2 MCMSUL11USC02 - MEDIA SUITE ULTIMATE MAINTENANCE
21210990-26A-E-36-Y1 - ADVISORMAIL BLOOMBERG ON BAND E 36MO Y1 MCMSU11USC03 - MEDIA SUITE ULTRA MAINTENANCE
21210990-26A-E-36-Y2 - ADVISORMAIL BLOOMBERG ON BAND E 36MO Y2 MCMSU11USC01 - MEDIA SUITE ULTRA MAINTENANCE
21210990-26A-E-36-Y3 - ADVISORMAIL BLOOMBERG ON BAND E 36MO Y3 MCMSU11USC02 - MEDIA SUITE ULTRA MAINTENANCE
21210990-26A-F-12 - ADVISORMAIL BLOOMBERG ON BAND F 12MO MCMSU11USC04 - MEDIA SUITE ULTRA MAINTENANCE
21210990-26A-F-24-Y1 - ADVISORMAIL BLOOMBERG ON BAND F 24MO Y1 MMESUSDLC03 - MEDIAESPRESSO MAINTENANCE
21210990-26A-F-24-Y2 - ADVISORMAIL BLOOMBERG ON BAND F 24MO Y2 MMESUSDLC04 - MEDIAESPRESSO MAINTENANCE
21210990-26A-F-36-Y1 - ADVISORMAIL BLOOMBERG ON BAND F 36MO Y1 MMESUSDLC01 - MEDIAESPRESSO MAINTENANCE
21210990-26A-F-36-Y2 - ADVISORMAIL BLOOMBERG ON BAND F 36MO Y2 MMESUSDLC02 - MEDIAESPRESSO MAINTENANCE
21210990-26A-F-36-Y3 - ADVISORMAIL BLOOMBERG ON BAND F 36MO Y3 WG019933 - MEDIUM OFFICE 1-YR DATA LOSS PREVENTION
21210990-26A-G-12 - ADVISORMAIL BLOOMBERG ON BAND G 12MO WG019937 - MEDIUM OFFICE 3-YR DATA LOSS PREVENTION
21210990-26A-G-24-Y1 - ADVISORMAIL BLOOMBERG ON BAND G 24MO Y1 SYM-515763415-A-MEGA - MEGA CO-TERM FOR AGL RESOURCES INC FOR QUOTE NUMBER 515763415 ONLY.
21210990-26A-G-24-Y2 - ADVISORMAIL BLOOMBERG ON BAND G 24MO Y2 SYM-515576944A1-MEGA - MEGA CO-TERM FOR ARAMARK FOR YEAR ONE FOR QUOTE NUMBER 515576944 ONLY.
21210990-26A-G-36-Y1 - ADVISORMAIL BLOOMBERG ON BAND G 36MO Y1 SYM-515549601-B-MEGA - MEGA CO-TERM FOR BHS NORTH COLORADO MEDICAL CENTER FOR QUOTE NUMBER 515549601 ON
21210990-26A-G-36-Y2 - ADVISORMAIL BLOOMBERG ON BAND G 36MO Y2 SYM-515769111-C-MEGA - MEGA CO-TERM FOR CRACKER BARRELL FOR YEAR 1 FOR QUOTE NUMBER 515769111 ONLY
21210990-26A-G-36-Y3 - ADVISORMAIL BLOOMBERG ON BAND G 36MO Y3 SYM-515769111C3-MEGA - MEGA CO-TERM FOR CRACKER BARRELL FOR YEAR 3 FOR QUOTE NUMBER 515769111 ONLY
21210990-28A-A-12 - ADVISORMAIL BLOOMBERGA 12 MONTH SYM-515769111C2-MEGA - MEGA CO-TERM FOR CRACKER BARRELL FOR YEAR TWO FOR QUOTE NUMBER 515769111 ONLY
21210990-28A-A-24-Y1 - ADVISORMAIL BLOOMBERGA 24 MONTH SYM-515755327-D-MEGA - MEGA CO-TERM FOR DEFENSE MANPOWER DATA CENTER FOR QUOTE NUMBER 515755327 ONLY.
21210990-28A-A-24-Y2 - ADVISORMAIL BLOOMBERGA 24 MONTH SYM-515767737-H-MEGA - MEGA CO-TERM FOR HIGH COMPANY LLC FOR QUOTE NUMBER 515767737 ONLY
21210990-28A-A-36-Y1 - ADVISORMAIL BLOOMBERGA 36 MONTH SYM-515624202-L-MEGA - MEGA CO-TERM FOR L 3 COMMUNICATIONS FOR QUOTE NUMBER 515624202 ONLY.
21210990-28A-A-36-Y3 - ADVISORMAIL BLOOMBERGA 36 MONTH SYM-515624306L-MEGA - MEGA CO-TERM FOR L 3 COMMUNICATIONS FOR QUOTE NUMBER 515624306 ONLY.
21210990-28A-A-36-Y2 - ADVISORMAIL BLOOMBERGA 36 MONTH SYM-515625368-L-MEGA - MEGA CO-TERM FOR L 3 COMMUNICATIONS FOR QUOTE NUMBER 515625368 ONLY.
21210990-28A-B-12 - ADVISORMAIL BLOOMBERGB 12 MONTH SYM-515787998-M-MEGA - MEGA CO-TERM FOR MATERION BRUSH INC FOR QUOTE NUMBER 515787998 ONLY.
21210990-28A-B-24-Y2 - ADVISORMAIL BLOOMBERGB 24 MONTH SYM-515705412-M-MEGA - MEGA CO-TERM FOR MED AMERICA FOR QUOTE# 515705412 ONLY
21210990-28A-B-24-Y1 - ADVISORMAIL BLOOMBERGB 24 MONTH SYM-515700322-M-MEGA - MEGA CO-TERM FOR MERKLE INC FOR QUOTE NUMBER 515700322 ONLY
21210990-28A-B-36-Y1 - ADVISORMAIL BLOOMBERGB 36 MONTH SYM-515525200-M-MEGA - MEGA CO-TERM FOR MITRE CORP FOR QUOTE NUMBER 515525200 FOR MITRE CORP ONLY.
21210990-28A-B-36-Y3 - ADVISORMAIL BLOOMBERGB 36 MONTH SYM-515769912-N-MEGA - MEGA CO-TERM FOR NATURE AMERICA INC FOR QUOTE NUMBER 515769912 ONLY.
21210990-28A-B-36-Y2 - ADVISORMAIL BLOOMBERGB 36 MONTH SYM-515781912-P-MEGA - MEGA CO-TERM FOR PORTFOLIO RECOVERY ASSOCIATES FOR QUOTE NUMBER 515781912 ONLY
21210990-28A-C-12 - ADVISORMAIL BLOOMBERGC 12 MONTH SYM-515748864-S-MEGA - MEGA CO-TERM FOR SIRIUS FOR QOUTE NUMBER 515748864 ONLY.
21210990-28A-C-24-Y2 - ADVISORMAIL BLOOMBERGC 24 MONTH SYM-515755049-U-MEGA - MEGA CO-TERM FOR UNITED STATES BANK NATIONAL ASSOCIATION FOR QUOTE NUMBER 515755
21210990-28A-C-24-Y1 - ADVISORMAIL BLOOMBERGC 24 MONTH SYM-515292018U-MEGA - MEGA CO-TERM FOR UNITED SURGICAL PARTNERS FOR QUOTE 515292018 ONLY.
21210990-28A-C-36-Y2 - ADVISORMAIL BLOOMBERGC 36 MONTH SYM-515725460-W-MEGA - MEGA CO-TERM FOR WESTAT INC FOR QUOTE NUMBER 515725460 ONLY.
21210990-28A-C-36-Y1 - ADVISORMAIL BLOOMBERGC 36 MONTH SYM-515725460W3-MEGA - MEGA CO-TERM FOR WESTAT INC FOR YEAR 3 FOR QUOTE NUMBER 515725460 ONLY.
21210990-28A-C-36-Y3 - ADVISORMAIL BLOOMBERGC 36 MONTH MR66-HW-SS - MERAKI MR66 CLOUD MANAGED AP
21210990-28A-D-12 - ADVISORMAIL BLOOMBERGD 12 MONTH 5S2-00005 - MICROSOFT AZURE SUBSCRIPTION SERVICES OPEN SHARED MONTHLY SUBSCRIPTIONS-VOLUMELI
21210990-28A-D-24-Y2 - ADVISORMAIL BLOOMBERGD 24 MONTH 5S2-00002 - MICROSOFT AZURE SUBSCRIPTION SERVICES OPEN SHARED SNGL MONTHLY SUBSCRIPTIONS-VOL
21210990-28A-D-24-Y1 - ADVISORMAIL BLOOMBERGD 24 MONTH U2V-00006 - MICROSOFTBING MAPS ENTERPRISE PLATFORM MONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN
21210990-28A-D-36-Y2 - ADVISORMAIL BLOOMBERGD 36 MONTH U2V-00006 - MICROSOFTBING MAPS ENTERPRISE PLATFORM MONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN
21210990-28A-D-36-Y3 - ADVISORMAIL BLOOMBERGD 36 MONTH CPTS-PRO-MIG - MIGRATION ASSISTANCE SERVICE FOR UP TO T
21210990-28A-D-36-Y1 - ADVISORMAIL BLOOMBERGD 36 MONTH CPTS-PRO-MIG-CISCO - MIGRATION OF 3RD PARTY CISCO TO - SINGLE
21210990-28A-E-12 - ADVISORMAIL BLOOMBERGE 12 MONTH CF-SVCARB2ASSTMN - MINNESOTA STATE CONTRACT 443022 ONLY
21210990-28A-E-24-Y1 - ADVISORMAIL BLOOMBERGE 24 MONTH DOCARCHSRVC-SETUP - MINREQUIRMONTHLYFEEFOR 10GIGABYTES
21210990-28A-E-24-Y2 - ADVISORMAIL BLOOMBERGE 24 MONTH ST-1YRGTPS247ES - MOBILE ARMOR - 1 YR GOLD TECH PHONE SUPPORT UPGRADE TO 24X7, ENTERPRISE ANNUAL S
21210990-28A-E-36-Y2 - ADVISORMAIL BLOOMBERGE 36 MONTH ST-1YRGTPS247WMS - MOBILE ARMOR - 1 YR GOLD TECH PHONE SUPPORT UPGRADE TO 24X7, WINDOWS MOBILE ANNU
21210990-28A-E-36-Y3 - ADVISORMAIL BLOOMBERGE 36 MONTH ST-ADMCERTRGCOM - MOBILE ARMOR - COMMERCIAL ADMINISTRATOR CERTIFICATION TRAINING-VIRTUAL-INSTRUCTO
21210990-28A-E-36-Y1 - ADVISORMAIL BLOOMBERGE 36 MONTH ST-ESDAADRAWM512S - MOBILE ARMOR - COMPREHENSIVE ANNUAL SUBSCRIPTION PER USER. INCLUDES:DATAARMOR/DR
21210990-28A-F-12 - ADVISORMAIL BLOOMBERGF 12 MONTH ST-DAASDAAFA512S - MOBILE ARMOR - DATAARMOR ANNUAL SUBSCRIPTION PER USER, INCLUDES:DATAARMOR, FILEA
21210990-28A-F-24-Y1 - ADVISORMAIL BLOOMBERGF 24 MONTH ST-DRASDRAFA512S - MOBILE ARMOR - DRIVEARMOR ANNUAL SUBSCRIPTION PER USER (DRIVE NOT INCL) INCLUDES
21210990-28A-F-24-Y2 - ADVISORMAIL BLOOMBERGF 24 MONTH ST-ADMCERTRGFED - MOBILE ARMOR - GOVERNMENT ADMINISTRATOR CERTIFICATION TRAINING-VIRTUAL-INSTRUCTO
21210990-28A-F-36-Y1 - ADVISORMAIL BLOOMBERGF 36 MONTH ST-WMSDAAWM512S - MOBILE ARMOR - WINDOWS MOBILE ANNUAL SUBSCRIPTION PER USER, INCLUDES:DATAARMOR F
21210990-28A-F-36-Y2 - ADVISORMAIL BLOOMBERGF 36 MONTH AMMD-GD-EDU-60 - MOBILE DEVICE 5 YEAR SKU
21210990-28A-F-36-Y3 - ADVISORMAIL BLOOMBERGF 36 MONTH 10NMXP25-CS - MOBILITY PREMIUM SOFTWARE MAINTENANCE
21210990-28A-G-12 - ADVISORMAIL BLOOMBERGG 12 MONTH 090NMPRMMNT2-CS - MOBILITY XE PREMIUM MAINTENANCE (2 YEARS)
21210990-28A-G-24-Y2 - ADVISORMAIL BLOOMBERGG 24 MONTH NBSP0231M - MONTHLY 500 FIRST YEAR BRIDGE SOFTWARE WARRANTY
21210990-28A-G-24-Y1 - ADVISORMAIL BLOOMBERGG 24 MONTH NBSP0241M - MONTHLY 500 FULL YEAR SOFTWARE WARRANTY
21210990-28A-G-36-Y3 - ADVISORMAIL BLOOMBERGG 36 MONTH SWS-SOTIMC-1M - MONTHLY SOFTWARE SUPPORT FOR SOTI
21210990-28A-G-36-Y2 - ADVISORMAIL BLOOMBERGG 36 MONTH MORREN - MORAE MAINTENANCE
21210990-28A-G-36-Y1 - ADVISORMAIL BLOOMBERGG 36 MONTH MPS12S100 - MPS12S100,MALWAREBYTES BUSINESS SUPPORT T1,TERM (MOS)12,SUPPORT LICENSE, 12 MONT
21210973-26A-A-12 - ADVISORMAIL IM ON CLOUD BAND A 12MO MPS12S1000 - MPS12S1000,MALWAREBYTES BUSINESS SUPPORT T4,TERM (MOS)12,SUPPORT LICENSE, 12 MON
21210973-26A-A-24-Y1 - ADVISORMAIL IM ON CLOUD BAND A 24MO Y1 MPS12S250 - MPS12S250,MALWAREBYTES BUSINESS SUPPORT T2,TERM (MOS)12,SUPPORT LICENSE, 12 MONT
21210973-26A-A-24-Y2 - ADVISORMAIL IM ON CLOUD BAND A 24MO Y2 MPS12S2500 - MPS12S2500,MALWAREBYTES BUSINESS SUPPORT T5,TERM (MOS)12,SUPPORT LICENSE, 12 MON
21210973-26A-A-36-Y1 - ADVISORMAIL IM ON CLOUD BAND A 36MO Y1 MPS12S500 - MPS12S500,MALWAREBYTES BUSINESS SUPPORT T3,TERM (MOS)12,SUPPORT LICENSE, 12 MONT
21210973-26A-A-36-Y2 - ADVISORMAIL IM ON CLOUD BAND A 36MO Y2 MPS12S5000 - MPS12S5000,MALWAREBYTES BUSINESS SUPPORT T6,TERM (MOS)12,SUPPORT LICENSE, 12 MON
21210973-26A-A-36-Y3 - ADVISORMAIL IM ON CLOUD BAND A 36MO Y3 MPS24S100 - MPS24S100,MALWAREBYTES BUSINESS SUPPORT T1,TERM (MOS)24,SUPPORT LICENSE, 24 MONT
21210973-26A-B-12 - ADVISORMAIL IM ON CLOUD BAND B 12MO MPS24S1000 - MPS24S1000,MALWAREBYTES BUSINESS SUPPORT T4,TERM (MOS)24,SUPPORT LICENSE, 24 MON
21210973-26A-B-24-Y1 - ADVISORMAIL IM ON CLOUD BAND B 24MO Y1 MPS24S250 - MPS24S250,MALWAREBYTES BUSINESS SUPPORT T2,TERM (MOS)24,SUPPORT LICENSE, 24 MONT
21210973-26A-B-24-Y2 - ADVISORMAIL IM ON CLOUD BAND B 24MO Y2 MPS24S2500 - MPS24S2500,MALWAREBYTES BUSINESS SUPPORT T5,TERM (MOS)24,SUPPORT LICENSE, 24 MON
21210973-26A-B-36-Y1 - ADVISORMAIL IM ON CLOUD BAND B 36MO Y1 MPS24S500 - MPS24S500,MALWAREBYTES BUSINESS SUPPORT T3,TERM (MOS)24,SUPPORT LICENSE, 24 MONT
21210973-26A-B-36-Y2 - ADVISORMAIL IM ON CLOUD BAND B 36MO Y2 MPS24S5000 - MPS24S5000,MALWAREBYTES BUSINESS SUPPORT T6,TERM (MOS)24,SUPPORT LICENSE, 24 MON
21210973-26A-B-36-Y3 - ADVISORMAIL IM ON CLOUD BAND B 36MO Y3 MPS36S100 - MPS36S100,MALWAREBYTES BUSINESS SUPPORT T1,TERM (MOS)36,SUPPORT LICENSE, 36 MONT
21210973-26A-C-12 - ADVISORMAIL IM ON CLOUD BAND C 12MO MPS36S1000 - MPS36S1000,MALWAREBYTES BUSINESS SUPPORT T4,TERM (MOS)36,SUPPORT LICENSE, 36 MON
21210973-26A-C-24-Y1 - ADVISORMAIL IM ON CLOUD BAND C 24MO Y1 MPS36S250 - MPS36S250,MALWAREBYTES BUSINESS SUPPORT T2,TERM (MOS)36,SUPPORT LICENSE, 36 MONT
21210973-26A-C-24-Y2 - ADVISORMAIL IM ON CLOUD BAND C 24MO Y2 MPS36S2500 - MPS36S2500,MALWAREBYTES BUSINESS SUPPORT T5,TERM (MOS)36,SUPPORT LICENSE, 36 MON
21210973-26A-C-36-Y1 - ADVISORMAIL IM ON CLOUD BAND C 36MO Y1 MPS36S500 - MPS36S500,MALWAREBYTES BUSINESS SUPPORT T3,TERM (MOS)36,SUPPORT LICENSE, 36 MONT
21210973-26A-C-36-Y2 - ADVISORMAIL IM ON CLOUD BAND C 36MO Y2 MPS36S5000 - MPS36S5000,MALWAREBYTES BUSINESS SUPPORT T6,TERM (MOS)36,SUPPORT LICENSE, 36 MON
21210973-26A-C-36-Y3 - ADVISORMAIL IM ON CLOUD BAND C 36MO Y3 MR18-HW-SS - MR18 CLOUD MANAGED AP
21210973-26A-D-12 - ADVISORMAIL IM ON CLOUD BAND D 12MO MSA-SB - MSA FOR STUDIO (ANNUAL MAINTENANCE)
21210973-26A-D-24-Y1 - ADVISORMAIL IM ON CLOUD BAND D 24MO Y1 21197163 - MSAG AND WEB FAMILY ADDL CONTACT BSC 1YR
21210973-26A-D-24-Y2 - ADVISORMAIL IM ON CLOUD BAND D 24MO Y2 21197164 - MSAG AND WEB FAMILY ADDL CONTACT ESS 1YR
21210973-26A-D-36-Y1 - ADVISORMAIL IM ON CLOUD BAND D 36MO Y1 P87015S-SETUP - MSGLBS EIM ADDLSETUP PER TRANSACTION
21210973-26A-D-36-Y2 - ADVISORMAIL IM ON CLOUD BAND D 36MO Y2 P87010S-SETUP - MSGLBS EIM SETUP PER TRANSACTION
21210973-26A-D-36-Y3 - ADVISORMAIL IM ON CLOUD BAND D 36MO Y3 P85500S-SETUP - MSGLBS PBE-Z SETUP PER TRANSACTION
21210973-26A-E-12 - ADVISORMAIL IM ON CLOUD BAND E 12MO P85235S-SETUP - MSGLBS WEB V2 ADDLIP SETUP PER IP RANGE
21210973-26A-E-24-Y1 - ADVISORMAIL IM ON CLOUD BAND E 24MO Y1 P85215S-SETUP - MSGLBS WEB V2 FIRST IP SETUP PERIP RANGE
21210973-26A-E-24-Y2 - ADVISORMAIL IM ON CLOUD BAND E 24MO Y2 P85220S-SETUP - MSGLBS WEB V2 FIRST IP SETUP PERIP RANGE
21210973-26A-E-36-Y1 - ADVISORMAIL IM ON CLOUD BAND E 36MO Y1 P85225S-SETUP - MSGLBS WEB V2 FIRST IP SETUPPER IP RANGE
21210973-26A-E-36-Y2 - ADVISORMAIL IM ON CLOUD BAND E 36MO Y2 P38295S-SETUP - MSGLBSEML DOMAIN SETUP PER DOMAIN
21210973-26A-E-36-Y3 - ADVISORMAIL IM ON CLOUD BAND E 36MO Y3 21210991-F-MSP - MSP - ARCHIVING BLACKBERRY OPTION
21210973-26A-F-12 - ADVISORMAIL IM ON CLOUD BAND F 12MO 21210991-B-MSP - MSP - ARCHIVING BLACKBERRY OPTION
21210973-26A-F-24-Y1 - ADVISORMAIL IM ON CLOUD BAND F 24MO Y1 21210991-D-MSP - MSP - ARCHIVING BLACKBERRY OPTION
21210973-26A-F-24-Y2 - ADVISORMAIL IM ON CLOUD BAND F 24MO Y2 21210991-A-MSP - MSP - ARCHIVING BLACKBERRY OPTION
21210973-26A-F-36-Y1 - ADVISORMAIL IM ON CLOUD BAND F 36MO Y1 21210991-C-MSP - MSP - ARCHIVING BLACKBERRY OPTION
21210973-26A-F-36-Y2 - ADVISORMAIL IM ON CLOUD BAND F 36MO Y2 21210991-E-MSP - MSP - ARCHIVING BLACKBERRY OPTION
21210973-26A-F-36-Y3 - ADVISORMAIL IM ON CLOUD BAND F 36MO Y3 21210971-A-MSP - MSP - ARCHIVING FOLDERY SYNC
21210973-26A-G-12 - ADVISORMAIL IM ON CLOUD BAND G 12MO 21210971-D-MSP - MSP - ARCHIVING FOLDERY SYNC
21210973-26A-G-24-Y1 - ADVISORMAIL IM ON CLOUD BAND G 24MO Y1 21210971-F-MSP - MSP - ARCHIVING FOLDERY SYNC
21210973-26A-G-24-Y2 - ADVISORMAIL IM ON CLOUD BAND G 24MO Y2 21210971-B-MSP - MSP - ARCHIVING FOLDERY SYNC
21210973-26A-G-36-Y1 - ADVISORMAIL IM ON CLOUD BAND G 36MO Y1 21210971-C-MSP - MSP - ARCHIVING FOLDERY SYNC
21210973-26A-G-36-Y2 - ADVISORMAIL IM ON CLOUD BAND G 36MO Y2 21210971-E-MSP - MSP - ARCHIVING FOLDERY SYNC
21210973-26A-G-36-Y3 - ADVISORMAIL IM ON CLOUD BAND G 36MO Y3 21210958-D-MSP - MSP - BOUNDARY ENCRYPTION
21210973-28A-A-12 - ADVISORMAIL IMA 12 MONTH 21210958-A-MSP - MSP - BOUNDARY ENCRYPTION
21210973-28A-A-24-Y1 - ADVISORMAIL IMA 24 MONTH 21210958-E-MSP - MSP - BOUNDARY ENCRYPTION
21210973-28A-A-24-Y2 - ADVISORMAIL IMA 24 MONTH 21210958-F-MSP - MSP - BOUNDARY ENCRYPTION
21210973-28A-A-36-Y3 - ADVISORMAIL IMA 36 MONTH 21210958-C-MSP - MSP - BOUNDARY ENCRYPTION
21210973-28A-A-36-Y1 - ADVISORMAIL IMA 36 MONTH 21210958-B-MSP - MSP - BOUNDARY ENCRYPTION
21210973-28A-A-36-Y2 - ADVISORMAIL IMA 36 MONTH 21210992-E-MSP - MSP - DISC & PERS ARCHIVE W/ CONTINUITY
21210973-28A-B-12 - ADVISORMAIL IMB 12 MONTH 21210992-C-MSP - MSP - DISC & PERS ARCHIVE W/ CONTINUITY
21210973-28A-B-24-Y2 - ADVISORMAIL IMB 24 MONTH 21210992-A-MSP - MSP - DISC & PERS ARCHIVE W/ CONTINUITY
21210973-28A-B-24-Y1 - ADVISORMAIL IMB 24 MONTH 21210992-B-MSP - MSP - DISC & PERS ARCHIVE W/ CONTINUITY
21210973-28A-B-36-Y2 - ADVISORMAIL IMB 36 MONTH 21210992-D-MSP - MSP - DISC & PERS ARCHIVE W/ CONTINUITY
21210973-28A-B-36-Y3 - ADVISORMAIL IMB 36 MONTH 21210992-F-MSP - MSP - DISC & PERS ARCHIVE W/ CONTINUITY
21210973-28A-B-36-Y1 - ADVISORMAIL IMB 36 MONTH 21210992-T-MSP - MSP - DISC & PERS ARCHIVE W/ CONTINUITY
21210973-28A-C-12 - ADVISORMAIL IMC 12 MONTH 21210906-D-MSP - MSP - DISCOVERY AND PERSONAL ARCHIVE
21210973-28A-C-24-Y1 - ADVISORMAIL IMC 24 MONTH 21210906-A-MSP - MSP - DISCOVERY AND PERSONAL ARCHIVE
21210973-28A-C-24-Y2 - ADVISORMAIL IMC 24 MONTH 21210906-C-MSP - MSP - DISCOVERY AND PERSONAL ARCHIVE
21210973-28A-C-36-Y3 - ADVISORMAIL IMC 36 MONTH 21210906-F-MSP - MSP - DISCOVERY AND PERSONAL ARCHIVE
21210973-28A-C-36-Y2 - ADVISORMAIL IMC 36 MONTH 21210906-T-MSP - MSP - DISCOVERY AND PERSONAL ARCHIVE
21210973-28A-C-36-Y1 - ADVISORMAIL IMC 36 MONTH 21210906-E-MSP - MSP - DISCOVERY AND PERSONAL ARCHIVE
21210973-28A-D-12 - ADVISORMAIL IMD 12 MONTH 21210906-B-MSP - MSP - DISCOVERY AND PERSONAL ARCHIVE
21210973-28A-D-24-Y1 - ADVISORMAIL IMD 24 MONTH 21211004-B-MSP - MSP - EMAIL & WEB AV/AS & URL FILTERING
21210973-28A-D-24-Y2 - ADVISORMAIL IMD 24 MONTH 21211004-D-MSP - MSP - EMAIL & WEB AV/AS & URL FILTERING
21210973-28A-D-36-Y2 - ADVISORMAIL IMD 36 MONTH 21211004-A-MSP - MSP - EMAIL & WEB AV/AS & URL FILTERING
21210973-28A-D-36-Y1 - ADVISORMAIL IMD 36 MONTH 21211004-E-MSP - MSP - EMAIL & WEB AV/AS & URL FILTERING
21210973-28A-D-36-Y3 - ADVISORMAIL IMD 36 MONTH 21211004-T-MSP - MSP - EMAIL & WEB AV/AS & URL FILTERING
21210973-28A-E-12 - ADVISORMAIL IME 12 MONTH 21211004-C-MSP - MSP - EMAIL & WEB AV/AS & URL FILTERING
21210973-28A-E-24-Y1 - ADVISORMAIL IME 24 MONTH 21211004-F-MSP - MSP - EMAIL & WEB AV/AS & URL FILTERING
21210973-28A-E-24-Y2 - ADVISORMAIL IME 24 MONTH 21210892-C-MSP - MSP - EMAIL AV/AS
21210973-28A-E-36-Y3 - ADVISORMAIL IME 36 MONTH 21210892-A-MSP - MSP - EMAIL AV/AS
21210973-28A-E-36-Y1 - ADVISORMAIL IME 36 MONTH 21210892-D-MSP - MSP - EMAIL AV/AS
21210973-28A-E-36-Y2 - ADVISORMAIL IME 36 MONTH 21210892-F-MSP - MSP - EMAIL AV/AS
21210973-28A-F-12 - ADVISORMAIL IMF 12 MONTH 21210892-B-MSP - MSP - EMAIL AV/AS
21210973-28A-F-24-Y1 - ADVISORMAIL IMF 24 MONTH 21210892-E-MSP - MSP - EMAIL AV/AS
21210973-28A-F-24-Y2 - ADVISORMAIL IMF 24 MONTH 21210892-T-MSP - MSP - EMAIL AV/AS
21210973-28A-F-36-Y3 - ADVISORMAIL IMF 36 MONTH 21210874-C-MSP - MSP - EMAIL AV/AS/IC/CC
21210973-28A-F-36-Y2 - ADVISORMAIL IMF 36 MONTH 21210874-B-MSP - MSP - EMAIL AV/AS/IC/CC
21210973-28A-F-36-Y1 - ADVISORMAIL IMF 36 MONTH 21210874-F-MSP - MSP - EMAIL AV/AS/IC/CC
21210973-28A-G-12 - ADVISORMAIL IMG 12 MONTH 21210874-A-MSP - MSP - EMAIL AV/AS/IC/CC
21210973-28A-G-24-Y1 - ADVISORMAIL IMG 24 MONTH 21210874-E-MSP - MSP - EMAIL AV/AS/IC/CC
21210973-28A-G-24-Y2 - ADVISORMAIL IMG 24 MONTH 21210874-D-MSP - MSP - EMAIL AV/AS/IC/CC
21210973-28A-G-36-Y2 - ADVISORMAIL IMG 36 MONTH 21210874-T-MSP - MSP - EMAIL AV/AS/IC/CC
21210973-28A-G-36-Y1 - ADVISORMAIL IMG 36 MONTH 21210876-T-MSP - MSP - EMAIL AV/AS/IC/CC & WEB AV/AS/URL
21210973-28A-G-36-Y3 - ADVISORMAIL IMG 36 MONTH 21210876-A-MSP - MSP - EMAIL AV/AS/IC/CC & WEB AV/AS/URL
21210972-26A-A-12 - ADVISORMAIL ON CLOUD BAND A 12MO 21210876-F-MSP - MSP - EMAIL AV/AS/IC/CC & WEB AV/AS/URL
21210972-26A-A-24-Y1 - ADVISORMAIL ON CLOUD BAND A 24MO YR1 21210876-B-MSP - MSP - EMAIL AV/AS/IC/CC & WEB AV/AS/URL
21210972-26A-A-24-Y2 - ADVISORMAIL ON CLOUD BAND A 24MO YR2 21210876-E-MSP - MSP - EMAIL AV/AS/IC/CC & WEB AV/AS/URL
21210972-26A-A-36-Y1 - ADVISORMAIL ON CLOUD BAND A 36MO YR1 21210876-C-MSP - MSP - EMAIL AV/AS/IC/CC & WEB AV/AS/URL
21210972-26A-A-36-Y2 - ADVISORMAIL ON CLOUD BAND A 36MO YR2 21210876-D-MSP - MSP - EMAIL AV/AS/IC/CC & WEB AV/AS/URL
21210972-26A-A-36-Y3 - ADVISORMAIL ON CLOUD BAND A 36MO YR3 21210984-F-MSP - MSP - INSTANT MESSAGING SECURITY SERVICE
21210972-26A-B-12 - ADVISORMAIL ON CLOUD BAND B 12MO 21210984-E-MSP - MSP - INSTANT MESSAGING SECURITY SERVICE
21210972-26A-B-24-Y1 - ADVISORMAIL ON CLOUD BAND B 24MO YR1 21210984-A-MSP - MSP - INSTANT MESSAGING SECURITY SERVICE
21210972-26A-B-24-Y2 - ADVISORMAIL ON CLOUD BAND B 24MO YR2 21210984-C-MSP - MSP - INSTANT MESSAGING SECURITY SERVICE
21210972-26A-B-36-Y1 - ADVISORMAIL ON CLOUD BAND B 36MO YR1 21210984-D-MSP - MSP - INSTANT MESSAGING SECURITY SERVICE
21210972-26A-B-36-Y2 - ADVISORMAIL ON CLOUD BAND B 36MO YR2 21210984-T-MSP - MSP - INSTANT MESSAGING SECURITY SERVICE
21210972-26A-B-36-Y3 - ADVISORMAIL ON CLOUD BAND B 36MO YR3 21210984-B-MSP - MSP - INSTANT MESSAGING SECURITY SERVICE
21210972-26A-C-12 - ADVISORMAIL ON CLOUD BAND C 12MO 21211036-MSP - MSP - LEGACY ARCHIVING DATA IMPORT
21210972-26A-C-24-Y1 - ADVISORMAIL ON CLOUD BAND C 24MO YR1 21210865-D-MSP - MSP - POLICY BASED ENCRYPTION ECHOWORX
21210972-26A-C-24-Y2 - ADVISORMAIL ON CLOUD BAND C 24MO YR2 21210865-A-MSP - MSP - POLICY BASED ENCRYPTION ECHOWORX
21210972-26A-C-36-Y1 - ADVISORMAIL ON CLOUD BAND C 36MO YR1 21210865-B-MSP - MSP - POLICY BASED ENCRYPTION ECHOWORX
21210972-26A-C-36-Y2 - ADVISORMAIL ON CLOUD BAND C 36MO YR2 21210865-C-MSP - MSP - POLICY BASED ENCRYPTION ECHOWORX
21210972-26A-C-36-Y3 - ADVISORMAIL ON CLOUD BAND C 36MO YR3 21210865-E-MSP - MSP - POLICY BASED ENCRYPTION ECHOWORX
21210972-26A-D-12 - ADVISORMAIL ON CLOUD BAND D 12MO 21210865-F-MSP - MSP - POLICY BASED ENCRYPTION ECHOWORX
21210972-26A-D-24-Y1 - ADVISORMAIL ON CLOUD BAND D 24MO YR1 21210865-T-MSP - MSP - POLICY BASED ENCRYPTION ECHOWORX
21210972-26A-D-24-Y2 - ADVISORMAIL ON CLOUD BAND D 24MO YR2 21210927-A-MSP - MSP - TLS LINK
21210972-26A-D-36-Y1 - ADVISORMAIL ON CLOUD BAND D 36MO YR1 21210969-A-MSP - MSP - WEB AV/AS/URL FILTERING
21210972-26A-D-36-Y2 - ADVISORMAIL ON CLOUD BAND D 36MO YR2 21210969-F-MSP - MSP - WEB AV/AS/URL FILTERING
21210972-26A-D-36-Y3 - ADVISORMAIL ON CLOUD BAND D 36MO YR3 21210969-B-MSP - MSP - WEB AV/AS/URL FILTERING
21210972-26A-E-12 - ADVISORMAIL ON CLOUD BAND E 12MO 21210969-D-MSP - MSP - WEB AV/AS/URL FILTERING
21210972-26A-E-24-Y1 - ADVISORMAIL ON CLOUD BAND E 24MO YR1 21210969-T-MSP - MSP - WEB AV/AS/URL FILTERING
21210972-26A-E-24-Y2 - ADVISORMAIL ON CLOUD BAND E 24MO YR2 21210969-E-MSP - MSP - WEB AV/AS/URL FILTERING
21210972-26A-E-36-Y1 - ADVISORMAIL ON CLOUD BAND E 36MO YR1 21210969-C-MSP - MSP - WEB AV/AS/URL FILTERING
21210972-26A-E-36-Y2 - ADVISORMAIL ON CLOUD BAND E 36MO YR2 21211020-D-MSP - MSP - WEB SMART CONNECT
21210972-26A-E-36-Y3 - ADVISORMAIL ON CLOUD BAND E 36MO YR3 21211020-E-MSP - MSP - WEB SMART CONNECT
21210972-26A-F-12 - ADVISORMAIL ON CLOUD BAND F 12MO 21211020-T-MSP - MSP - WEB SMART CONNECT
21210972-26A-F-24-Y1 - ADVISORMAIL ON CLOUD BAND F 24MO YR1 21211020-F-MSP - MSP - WEB SMART CONNECT
21210972-26A-F-24-Y2 - ADVISORMAIL ON CLOUD BAND F 24MO YR2 21211020-A-MSP - MSP - WEB SMART CONNECT
21210972-26A-F-36-Y1 - ADVISORMAIL ON CLOUD BAND F 36MO YR1 21211020-B-MSP - MSP - WEB SMART CONNECT
21210972-26A-F-36-Y2 - ADVISORMAIL ON CLOUD BAND F 36MO YR2 21211020-C-MSP - MSP - WEB SMART CONNECT
21210972-26A-F-36-Y3 - ADVISORMAIL ON CLOUD BAND F 36MO YR3 RB-HS - MSPOEMEND-USER-FAQHELP HOSTING SRVC
21210972-26A-G-12 - ADVISORMAIL ON CLOUD BAND G 12MO 21286239 - MSS 1GBPS IDP SENSOR 36M BASD SUB EXP S
21210972-26A-G-24-Y1 - ADVISORMAIL ON CLOUD BAND G 24MO YR1 21285186 - MSS ADV MM SVC NTW 36M BASED SUBS EXP S
21210972-26A-G-24-Y2 - ADVISORMAIL ON CLOUD BAND G 24MO YR2 21286633 - MSS ESS SEC 10DVCS 36M BASED SUBS EXP S
21210972-26A-G-36-Y1 - ADVISORMAIL ON CLOUD BAND G 36MO YR1 21286003 - MSS HS CNS PM D 36M BASD SUB EXP S
21210972-26A-G-36-Y2 - ADVISORMAIL ON CLOUD BAND G 36MO YR2 21289608 - MSS INI SVP NTW D ONE TIME FEE EXP S
21210972-26A-G-36-Y3 - ADVISORMAIL ON CLOUD BAND G 36MO YR3 21289598 - MSS S INI SVCOR ONE TIME FEE EXP S
21210972-28A-A-12 - ADVISORMAILA 12 MONTH 124940-ASP - MTNCE ADDL QXMLA ADAPTER, MS SHAREPOINT
21210972-28A-A-24-Y2 - ADVISORMAILA 24 MONTH 124940-MSP - MTNCE MSP ACCELERATOR FOR QXML AUTHOR
21210972-28A-A-24-Y1 - ADVISORMAILA 24 MONTH 124940-DM - MTNCE QXML AUTH ADAPTER TO DOCUMENTUM
21210972-28A-A-36-Y1 - ADVISORMAILA 36 MONTH 124940-FNM - MTNCE QXML AUTH ADAPTER TO IBM P8
21210972-28A-A-36-Y3 - ADVISORMAILA 36 MONTH 124940-OTM - MTNCE QXML AUTH ADAPTER TO OPEN TEXT
21210972-28A-A-36-Y2 - ADVISORMAILA 36 MONTH 124940-SPM - MTNCE QXML AUTH ADAPTER, MS SHAREPOINT
21210972-28A-B-12 - ADVISORMAILB 12 MONTH 7015471-7017606-ENT - MULTPLEX GRID OPTION FYM ENT SUPRT
21210972-28A-B-24-Y2 - ADVISORMAILB 24 MONTH 7015470-7017606-STD - MULTPLEX GRID OPTION FYM STD SUPRT
21210972-28A-B-24-Y1 - ADVISORMAILB 24 MONTH S1005-0001 - MYDOX ANNUAL SUPPORT-(1-10 LICENSES)
21210972-28A-B-36-Y3 - ADVISORMAILB 36 MONTH S1005-1000 - MYDOX ANNUAL SUPPORT-(1000-1999 LICENSE)
21210972-28A-B-36-Y2 - ADVISORMAILB 36 MONTH S1005-0011 - MYDOX ANNUAL SUPPORT-(11-49 LICENSES)
21210972-28A-B-36-Y1 - ADVISORMAILB 36 MONTH S1005-0150 - MYDOX ANNUAL SUPPORT-(150-499 LICENSES)
21210972-28A-C-12 - ADVISORMAILC 12 MONTH S1005-2000 - MYDOX ANNUAL SUPPORT-(2000+ LICENSES)
21210972-28A-C-24-Y1 - ADVISORMAILC 24 MONTH S1005-0050 - MYDOX ANNUAL SUPPORT-(50-149 LICENSES)
21210972-28A-C-24-Y2 - ADVISORMAILC 24 MONTH S1005-0500 - MYDOX ANNUAL SUPPORT-(500-999 LICENSES)
21210972-28A-C-36-Y3 - ADVISORMAILC 36 MONTH S1006 - MYDOX MONTHLY SUPPORT-CHARGE PER LICENSE
21210972-28A-C-36-Y1 - ADVISORMAILC 36 MONTH S1007 - MYDOX SUPPORT-A LA CARTE, PER CALL
21210972-28A-C-36-Y2 - ADVISORMAILC 36 MONTH DESHOINMT - N-CENTRAL PROFESSIONAL DESKTOP
21210972-28A-D-12 - ADVISORMAILD 12 MONTH SERHOINMT - N-CENTRAL PROFESSIONAL SERVER
21210972-28A-D-24-Y2 - ADVISORMAILD 24 MONTH PSHOUR - NANONATION PROFESSIONAL SERVICE HOUR
21210972-28A-D-24-Y1 - ADVISORMAILD 24 MONTH VAR-AFT-IBSR-1ST2 - NDI ON-SITE SUPPORT - INCIDENT BASED
21210972-28A-D-36-Y3 - ADVISORMAILD 36 MONTH NP-AX100-IR-3 - NERVEPOINT ACCESS MANAGER AX100 IR
21210972-28A-D-36-Y1 - ADVISORMAILD 36 MONTH NP-AX100-IR-1 - NERVEPOINT ACCESS MANAGER AX100 IR
21210972-28A-D-36-Y2 - ADVISORMAILD 36 MONTH NP-AX100-IR-5 - NERVEPOINT ACCESS MANAGER AX100 IR
21210972-28A-E-12 - ADVISORMAILE 12 MONTH NP-AX100-UPDATE-1 - NERVEPOINT ACCESS MANAGER AX100 SUPPORT
21210972-28A-E-24-Y2 - ADVISORMAILE 24 MONTH NP-AX100-UPDATE-5 - NERVEPOINT ACCESS MANAGER AX100 SUPPORT
21210972-28A-E-24-Y1 - ADVISORMAILE 24 MONTH NP-AX100-UPDATE-3 - NERVEPOINT ACCESS MANAGER AX100 SUPPORT
21210972-28A-E-36-Y2 - ADVISORMAILE 36 MONTH NP-AX200-IR-1 - NERVEPOINT ACCESS MANAGER AX200 IR
21210972-28A-E-36-Y3 - ADVISORMAILE 36 MONTH NP-AX200-IR-3 - NERVEPOINT ACCESS MANAGER AX200 IR
21210972-28A-E-36-Y1 - ADVISORMAILE 36 MONTH NP-AX200-IR-5 - NERVEPOINT ACCESS MANAGER AX200 IR
21210972-28A-F-12 - ADVISORMAILF 12 MONTH NP-AX200-UPDATE-1 - NERVEPOINT ACCESS MANAGER AX200 SUPPORT
21210972-28A-F-24-Y1 - ADVISORMAILF 24 MONTH NP-AX200-UPDATE-5 - NERVEPOINT ACCESS MANAGER AX200 SUPPORT
21210972-28A-F-24-Y2 - ADVISORMAILF 24 MONTH NP-AX200-UPDATE-3 - NERVEPOINT ACCESS MANAGER AX200 SUPPORT
21210972-28A-F-36-Y1 - ADVISORMAILF 36 MONTH NP-AX400-IR-5 - NERVEPOINT ACCESS MANAGER AX400 IR
21210972-28A-F-36-Y3 - ADVISORMAILF 36 MONTH NP-AX400-IR-1 - NERVEPOINT ACCESS MANAGER AX400 IR
21210972-28A-F-36-Y2 - ADVISORMAILF 36 MONTH NP-AX400-IR-3 - NERVEPOINT ACCESS MANAGER AX400 IR
21210972-28A-G-12 - ADVISORMAILG 12 MONTH NP-AX400-UPDATE-5 - NERVEPOINT ACCESS MANAGER AX400 SUPPORT
21210972-28A-G-24-Y2 - ADVISORMAILG 24 MONTH NP-AX400-UPDATE-1 - NERVEPOINT ACCESS MANAGER AX400 SUPPORT
21210972-28A-G-24-Y1 - ADVISORMAILG 24 MONTH NP-AX400-UPDATE-3 - NERVEPOINT ACCESS MANAGER AX400 SUPPORT
21210972-28A-G-36-Y3 - ADVISORMAILG 36 MONTH NP-AX800-IR-1 - NERVEPOINT ACCESS MANAGER AX800 IR
21210972-28A-G-36-Y2 - ADVISORMAILG 36 MONTH NP-AX800-IR-5 - NERVEPOINT ACCESS MANAGER AX800 IR
21210972-28A-G-36-Y1 - ADVISORMAILG 36 MONTH NP-AX800-IR-3 - NERVEPOINT ACCESS MANAGER AX800 IR
TPTI0009276137C - ADVIZEX FSC 2014 NP-AX800-UPDATE-1 - NERVEPOINT ACCESS MANAGER AX800 SUPPORT
TPTI-PR15B1P054C - ADVIZEX FSC 2014 NP-AX800-UPDATE-3 - NERVEPOINT ACCESS MANAGER AX800 SUPPORT
AECLTLICMT1YR - AE CLIENT 1Y MAINTACE - 1-99LCSES NP-AX800-UPDATE-5 - NERVEPOINT ACCESS MANAGER AX800 SUPPORT
AFTHRSRMM - AFTER HOURS HELP DESK PER SEAT AND GFI NP-PERPETUAL-UPDATE-50 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
4899V - AGISTICS WINDOWS FORMS CORPORATE RENEWAL NP-PERPETUAL-UPDATE-100 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
38039312 - AGRMT: (NF) WEP B721 OVERNIGHT EXCH 2YR NP-PERPETUAL-UPDATE-400 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
38039313 - AGRMT: (NF) WEP B721 OVERNIGHT EXCH 3YR NP-PERPETUAL-UPDATE-500 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
38039314 - AGRMT: (NF) WEP B721 OVERNIGHT EXCH 4YR NP-PERPETUAL-UPDATE-2000 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
38039315 - AGRMT: (NF) WEP B721 OVERNIGHT EXCH 5YR NP-PERPETUAL-UPDATE-10 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
38034813 - AGRMT: (NF) WEP MB770MFP 3YR ONSITE (VIRTUAL) NP-PERPETUAL-UPDATE-5000 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
38035013 - AGRMT: (NF) WEP MC780MFP 3YR ONSITE NP-PERPETUAL-UPDATE-300 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
5266.400.WW - ALLROUND AUTOMATION- ANNUAL SERVICE CONTRACT FOR 400 WORLDWIDE LICENSES NP-PERPETUAL-UPDATE-1000 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
PBS-HL-MNT - ALTAIR EXTRA YEAR OF MAINTENANCE FOR A SOCKET BASED PBS LICENSE. NP-PERPETUAL-UPDATE-1500 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
WAPCL2Y - AMER CLOUD COMMAND 2 YEAR LICENSE NP-PERPETUAL-UPDATE-25 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
WAPCL5Y - AMER CLOUD COMMAND 5 YEAR LICENSE NP-PERPETUAL-UPDATE-200 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
AMMD-GDOC-MTC-36 - AMMD MAINTENCE 3YR ORANGE COUNTY PS ONLY NP-PERPETUAL-UPDATE-2500 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
EC-SVS-ANALYTICS - ANALYTICS - 3 DAY ON-SITE INSTALLATION NP-PERPETUAL-UPDATE-10000 - NERVEPOINT ACCESS MANAGER VX MAINTENANCE
7015884-7017696-ENT - ANALYTICS EDITION (CS) FYM ENT SUPRT AT-X610-48TS-POE+-NCA-1 - NET.COVER ADVANCED SERVICE PRGRAM 1 YEAR
7015884-7017691-ENT - ANALYTICS EDITION (CS) FYM ENT SUPRT AT-XPSR-NCA-1 - NET.COVER ADVANCED SERVICE PRGRAM 1 YEAR
7015886-7017691-STD - ANALYTICS EDITION (CS) FYM STD SUPRT AT-SP10SR-NCA-1 - NET.COVER ADVANCED SERVICE PRGRAM 1 YEAR
7015886-7017696-STD - ANALYTICS EDITION (CS) FYM STD SUPRT AT-SBX3112-NCA-1 - NET.COVER ADVANCED SERVICE PRGRAM 1 YEAR
7015884-7017695-ENT - ANALYTICS EDITION (USER) FYM ENT SUPRT AT-XEM-2XP-NCA-1 - NET.COVER ADVANCED SERVICE PRGRAM 1 YEAR
7015886-7017695-STD - ANALYTICS EDITION (USER) FYM STD SUPRT AT-PWR05-NCA-1 - NET.COVER ADVANCED SVICE PROGRAM 1 YEAR
SVC-SW-3510DMP5 - ANN.PPD CONT.OF SUPT SW-DM-3510,YR5+ AT-PWR1200-NCA-1 - NET.COVER ADVANCED SVICE PROGRAM 1 YEAR
SVC-SW-2260DM - ANN.PPD SUPT SW-DM-2260 90411 - NET2PRINTER - MAINTENANCE
SVC-SW-2260DM-R - ANN.PPD SUPT SW-DM-2260 90421 - NET2PRINTER 10-99 MAINTENANCE
SVC-SW-3310DM - ANN.PPD SUPT SW-DM-3310 90431 - NET2PRINTER 100-499 MAINTENANCE
SVC-SW-3510DM - ANN.PPD SUPT SW-DM-3510 90441 - NET2PRINTER 500-999 MAINTENANCE
SVC-SW-6520DM - ANN.PPD SUPT SW-DM-6520 9199PT - NETADVANTAGE ULTIMATE 3 YEAR PRIORITY
SVC-SW-6720DM - ANN.PPD SUPT SW-DM-6720 9199ST - NETADVANTAGE ULTIMATE 3 YEAR RENEWAL
SVC-SW-3510DMFC - ANN.PPD SUPT SW-DMFC-3510 9199L - NETADVANTAGE ULTIMATE LATE RENEWAL
SVC-SW-3510DMFC - ANN.PPD SUPT SW-DMFC-3510 4899L - NETADVANTAGE WINDOWS FORMS LATE RENEWAL
SVC-SW-6520DMFC - ANN.PPD SUPT SW-DMFC-6520 11451088 - NETBACKUP FAMILY
SVC-SW-6520DMFC - ANN.PPD SUPT SW-DMFC-6520 11451089 - NETBACKUP FAMILY
SVC-SW-6720DMFC - ANN.PPD SUPT SW-DMFC-6720 NC8XPRE1YR-REN - NETC RUNCH 8.X PREMIUM 125 - 1 YEAR MAINTENANCE NETC RUNCH 8.X REMOTE ACCESS FOR
SVC-SW-6720DMFC - ANN.PPD SUPT SW-DMFC-6720 NVN-HWWARS-NVE501-MSP - NETSOCKET ADVANCED HW REPLACEMENT & SUPPORT
SVC-SW-3310DMFC - ANN.PPD SUPT SW-DMFC3310 NVNBUNDMSPSUPPSVCHWWNVE501MSP - NETSOCKET ONE YEAR HW WARRANTY & ADV REPLACEMENT SVC, SW MAINT/SUPPORT, VNETCAAS
SVC-SW-3310DMFC - ANN.PPD SUPT SW-DMFC3310 DEVMNRMWCH - NETWORK DEVICE MANAGE AND GFI MAX RMM
SVC-SW-3310DRSTR - ANN.PPD SUPT SW-DRSTR-3310 7015471-7017639-ENT - NETWORKED CLIENT FYM ENT SUPRT
SVC-SW-3310DRSTR - ANN.PPD SUPT SW-DRSTR-3310 7015470-7017639-STD - NETWORKED CLIENT FYM STD SUPRT
SVC-SW-3510DRSTR - ANN.PPD SUPT SW-DRSTR-3510 NW-P-AD-30000P-U - NETWRIX ACTIVE DIRECTORY I YEAR MAINTENANCE
SVC-SW-3510DRSTR - ANN.PPD SUPT SW-DRSTR-3510 NW-P-AIO-29999-U-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-6520DRSTR - ANN.PPD SUPT SW-DRSTR-6520 NW-MB-AIO-4999-U-1YR - NETWRIX ALL IN ONE SUITE
SVC-SW-6520DRSTR - ANN.PPD SUPT SW-DRSTR-6520 NW-MS-AIO-4999-U-1YR - NETWRIX ALL IN ONE SUITE
SVC-SW-6720DRSTR - ANN.PPD SUPT SW-DRSTR-6720 NW-P-AIO-999-U - NETWRIX ALL IN ONE SUITE
SVC-SW-6720DRSTR - ANN.PPD SUPT SW-DRSTR-6720 NW-P-AIO-9999-U - NETWRIX ALL IN ONE SUITE
SVC-SW-3510GN - ANN.PPD SUPT SW-GN-3510 NW-P-AIO-4999-U - NETWRIX ALL IN ONE SUITE
SVC-SW-6520GN - ANN.PPD SUPT SW-GN-6520 NW-MB-AIO-29999-U-1YR - NETWRIX ALL IN ONE SUITE
SVC-SW-6720GN - ANN.PPD SUPT SW-GN-6720 NW-MS-AIO-999-U-1YR - NETWRIX ALL IN ONE SUITE
SVC-SW-3310GN - ANN.PPD SUPT SW-GN3310 NW-MB-AIO-4999-U-3YR - NETWRIX ALL IN ONE SUITE
SVC-SW-3310HA33 - ANN.PPD SUPT SW-HA-3310 NW-MB-AIO-29999-U-3YR - NETWRIX ALL IN ONE SUITE
SVC-SW-3310HA - ANN.PPD SUPT SW-HA-3310 NW-HC-AIO-9999-U - NETWRIX ALL IN ONE SUITE
SVC-SW-3310HA33 - ANN.PPD SUPT SW-HA-3310 NW-MB-AIO-149-FP-1YR-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-3510HA - ANN.PPD SUPT SW-HA-3510 NW-MB-AIO-9999-U-2YR-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-3310NDMP - ANN.PPD SUPT SW-NDMP-3310 NW-MS-AIO-149-FP-2YR-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-3310NDMP - ANN.PPD SUPT SW-NDMP-3310 NW-MS-AIO-999-U-2YR-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-3510NDMP - ANN.PPD SUPT SW-NDMP-3510 NW-JS-AIO-4999-U-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-3510NDMP - ANN.PPD SUPT SW-NDMP-3510 NW-JS-AIO-29999-U-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-6520NDMP - ANN.PPD SUPT SW-NDMP-6520 NW-MS-AIO-999-U-1YR-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-6520NDMP - ANN.PPD SUPT SW-NDMP-6520 NW-MS-AIO-9999-U-1YR-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-6720NDMP - ANN.PPD SUPT SW-NDMP-6720 NW-MB-AIO-149-FP-3YR-PS - NETWRIX ALL IN ONE SUITE
SVC-SW-6720NDMP - ANN.PPD SUPT SW-NDMP-6720 NW-MB-AIO-9999-U-3YR-PS - NETWRIX ALL IN ONE SUITE
7283-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-4999-U-3YR-PS - NETWRIX ALL IN ONE SUITE
7361-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-9999-U-3YR-PS - NETWRIX ALL IN ONE SUITE
7376-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-P-AIO-9999-U-PS - NETWRIX ALL IN ONE SUITE
7040-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-999-U-2YR - NETWRIX ALL IN ONE SUITE
7367-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-29999-U-2YR - NETWRIX ALL IN ONE SUITE
7017-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-999-U-3YR - NETWRIX ALL IN ONE SUITE
7085-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-P-AIO-999-U-PS - NETWRIX ALL IN ONE SUITE
7043-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-P-AIO-29999-U - NETWRIX ALL IN ONE SUITE
7160-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-9999-U-1YR - NETWRIX ALL IN ONE SUITE
7271-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-29999-U-1YR - NETWRIX ALL IN ONE SUITE
7451-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-29999-U-2YR - NETWRIX ALL IN ONE SUITE
7400-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-9999-U-3YR - NETWRIX ALL IN ONE SUITE
7049-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-29999-U-3YR - NETWRIX ALL IN ONE SUITE
7118-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-HC-AIO-4999-U - NETWRIX ALL IN ONE SUITE
7130-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-HC-AIO-29999-U - NETWRIX ALL IN ONE SUITE
7310-1-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-P-AIO-149-FP-PS - NETWRIX ALL IN ONE SUITE
7037-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-4999-U-2YR - NETWRIX ALL IN ONE SUITE
7280-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-JS-AIO-149-FP - NETWRIX ALL IN ONE SUITE
7166-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-JS-AIO-999-U - NETWRIX ALL IN ONE SUITE
7031-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-JS-AIO-4999-U - NETWRIX ALL IN ONE SUITE
7304-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-999-U-2YR - NETWRIX ALL IN ONE SUITE
7370-7-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-9999-U-2YR - NETWRIX ALL IN ONE SUITE
7121-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-HC-AIO-149-FP - NETWRIX ALL IN ONE SUITE
7298-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-999-U-1YR - NETWRIX ALL IN ONE SUITE
7109-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-9999-U-1YR - NETWRIX ALL IN ONE SUITE
7091-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-149-FP-2YR - NETWRIX ALL IN ONE SUITE
7064-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-9999-U-2YR - NETWRIX ALL IN ONE SUITE
7094-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-149-FP-2YR - NETWRIX ALL IN ONE SUITE
7310-2-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-149-FP-3YR - NETWRIX ALL IN ONE SUITE
7013-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-999-U-3YR - NETWRIX ALL IN ONE SUITE
7076-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-9999-U-3YR - NETWRIX ALL IN ONE SUITE
7100-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-JS-AIO-29999-U - NETWRIX ALL IN ONE SUITE
7106-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-HC-AIO-999-U - NETWRIX ALL IN ONE SUITE
7370-1-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-P-AIO-4999-U-PS - NETWRIX ALL IN ONE SUITE
7370-2-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-149-FP-1YR - NETWRIX ALL IN ONE SUITE
7016-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-149-FP-1YR - NETWRIX ALL IN ONE SUITE
7163-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-149-FP-3YR - NETWRIX ALL IN ONE SUITE
7196-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-4999-U-2YR - NETWRIX ALL IN ONE SUITE
7268-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-4999-U-3YR - NETWRIX ALL IN ONE SUITE
7370-3-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-JS-AIO-9999-U - NETWRIX ALL IN ONE SUITE
7370-6-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-P-AIO-149-FP - NETWRIX ALL IN ONE SUITE
7395-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-149-FP-1YR-PS - NETWRIX ALL IN ONE SUITE
7067-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-4999-U-1YR-PS - NETWRIX ALL IN ONE SUITE
7079-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-999-U-3YR-PS - NETWRIX ALL IN ONE SUITE
7097-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-4999-U-3YR-PS - NETWRIX ALL IN ONE SUITE
7301-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-149-FP-3YR-PS - NETWRIX ALL IN ONE SUITE
7058-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-999-U-3YR-PS - NETWRIX ALL IN ONE SUITE
7307-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-29999-U-3YR-PS - NETWRIX ALL IN ONE SUITE
7292-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-999-U-1YR-PS - NETWRIX ALL IN ONE SUITE
7394-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MB-AIO-29999-U-2YR-PS - NETWRIX ALL IN ONE SUITE
7133-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-4999-U-2YR-PS - NETWRIX ALL IN ONE SUITE
7127-SWMAINT - ANNUAL BASIC MAINTENANCE AND SUPPORT NW-MS-AIO-29999-U-2YR-PS - NETWRIX ALL IN ONE SUITE
CPS - ANNUAL COMMANDPOINT SUPPORT NW-JS-AIO-999-U-PS - NETWRIX ALL IN ONE SUITE
CF-SVCSWDEVSUP - ANNUAL DEVELOPMENT SUPPORT CONTRACT NW-JS-AIO-9999-U-PS - NETWRIX ALL IN ONE SUITE
CPTS-ATC-PF - ANNUAL FEE - REQUIRED PER TRAINING LOCAT NW-MB-AIO-29999-U-1YR-PS - NETWRIX ALL IN ONE SUITE
PM0-150H - ANNUAL LICENSE FEE FOR 0-150 FULL TIME E NW-MB-AIO-9999-U-1YR-PS - NETWRIX ALL IN ONE SUITE
PM0-150L - ANNUAL LICENSE FEE FOR 0-150 FULL TIME E NW-MS-AIO-29999-U-1YR-PS - NETWRIX ALL IN ONE SUITE
PM1501-2500L - ANNUAL LICENSE FEE FOR 1501-2500 FULL TI NW-MB-AIO-29999-U-3YR-PS - NETWRIX ALL IN ONE SUITE
PM1501-2500H - ANNUAL LICENSE FEE FOR 1501-2500 FULL TI NW-MB-AIO-999-U-2YR-PS - NETWRIX ALL IN ONE SUITE
PM151-500L - ANNUAL LICENSE FEE FOR 151-500 FULL TIME NW-MB-AIO-4999-U-1YR-PS - NETWRIX ALL IN ONE SUITE
PM151-500H - ANNUAL LICENSE FEE FOR 151-5000 FULL TIM NW-MB-AIO-149-FP-2YR-PS - NETWRIX ALL IN ONE SUITE
PM2501-5000H - ANNUAL LICENSE FEE FOR 2501-5000 FULL TI NW-MB-AIO-4999-U-2YR-PS - NETWRIX ALL IN ONE SUITE
PM2501-5000L - ANNUAL LICENSE FEE FOR 2501-5000 FULL TI NW-MS-AIO-9999-U-2YR-PS - NETWRIX ALL IN ONE SUITE
PM5001L - ANNUAL LICENSE FEE FOR 5000 OR GREATER F NW-JS-AIO-149-FP-PS - NETWRIX ALL IN ONE SUITE
PM5001H - ANNUAL LICENSE FEE FOR 5000 OR GREATER F NW-P-AD-PS - NETWRIX AUDITOR ACTIVE DIRECTORY W/1ST YEAR SUPPORT & MAINTENANCE
PM501-1500L - ANNUAL LICENSE FEE FOR 501-1500 FULL TIM NW-P-AA-4999-U-PS - NETWRIX AUDITOR - ALL
PM501-1500H - ANNUAL LICENSE FEE FOR 501-1500 FULL TIM NW-MS-AA-999-U-1YR - NETWRIX AUDITOR - ALL
CTLXX5-M - ANNUAL MAINTENANCE AND SUPPORT FOR CONTROL 5 NW-MB-AA-4999-U-2YR - NETWRIX AUDITOR - ALL
RB-STDTBLAMS - ANNUAL MAINTENANCE AND SUPPORT FOR STANDARD EDITION YEAR 2 NW-MS-AA-999-U-2YR - NETWRIX AUDITOR - ALL
124941-SME-1-4A - ANNUAL MAINTENANCE RENEWAL FOR QUARK XML AUTHOR 4 SME, GOV, 1:4 RATIO, LEVEL A 1 NW-MB-AA-4999-U-3YR - NETWRIX AUDITOR - ALL
124941-1-4A - ANNUAL MAINTENANCE RENEWAL FOR QUARK XML AUTHOR GOV, 1:4 RATIO, LEVEL A 1-99 USE NW-JS-AA-149-FP - NETWRIX AUDITOR - ALL
124941-MSP - ANNUAL MAINTENANCE RENEWAL, MSP ACCELERATOR MAINTENANCE GOV NW-HC-AA-149-FP - NETWRIX AUDITOR - ALL
SVC-SW-3110HA - ANNUAL PPD SOFTWARE SUBSCRIPTION SERVICES FOR ONS-SW-3110-HA NW-MB-AA-4999-U-1YR - NETWRIX AUDITOR - ALL
124940 - ANNUAL SOFTWARE LICENSE MAINTENANCE NW-MB-AA-999-U-2YR - NETWRIX AUDITOR - ALL
124940-SME - ANNUAL SOFTWARE LICENSE MAINTENANCE NW-MB-AA-149-FP-1YR - NETWRIX AUDITOR - ALL
MAINT-SCSP - ANNUAL SOFTWARE MAINTENANCE FEE NW-MS-AA-9999-U-1YR - NETWRIX AUDITOR - ALL
AS-T1H-0250-0499 - ANNUAL SUPPORT & HOSTING TIER-1 NW-MB-AA-149-FP-3YR - NETWRIX AUDITOR - ALL
AS-T1H-0010-0049 - ANNUAL SUPPORT & HOSTING TIER-1 NW-JS-AA-4999-U - NETWRIX AUDITOR - ALL
AS-T1H-2000-9999 - ANNUAL SUPPORT & HOSTING TIER-1 NW-MB-AA-149-FP-2YR - NETWRIX AUDITOR - ALL
AS-T1H-0001-0009 - ANNUAL SUPPORT & HOSTING TIER-1 NW-MS-AA-9999-U-2YR - NETWRIX AUDITOR - ALL
AS-T1H-0050-0099 - ANNUAL SUPPORT & HOSTING TIER-1 NW-JS-AA-29999-U - NETWRIX AUDITOR - ALL
AS-T1H-1000-1999 - ANNUAL SUPPORT & HOSTING TIER-1 NW-HC-AA-9999-U - NETWRIX AUDITOR - ALL
AS-T1H-0500-0999 - ANNUAL SUPPORT & HOSTING TIER-1 NW-P-AA-149-FP - NETWRIX AUDITOR - ALL
AS-T1H-0100-0249 - ANNUAL SUPPORT & HOSTING TIER-1 NW-P-AA-4999-U - NETWRIX AUDITOR - ALL
AS-T2H-2000-9999 - ANNUAL SUPPORT & HOSTING TIER-2 NW-MB-AA-999-U-1YR - NETWRIX AUDITOR - ALL
AS-T2H-0001-0009 - ANNUAL SUPPORT & HOSTING TIER-2 NW-MB-AA-9999-U-1YR - NETWRIX AUDITOR - ALL
AS-T2H-0100-0249 - ANNUAL SUPPORT & HOSTING TIER-2 NW-MS-AA-149-FP-1YR - NETWRIX AUDITOR - ALL
AS-T2H-0500-0999 - ANNUAL SUPPORT & HOSTING TIER-2 NW-MS-AA-29999-U-1YR - NETWRIX AUDITOR - ALL
AS-T2H-0250-0499 - ANNUAL SUPPORT & HOSTING TIER-2 NW-MS-AA-29999-U-2YR - NETWRIX AUDITOR - ALL
AS-T2H-1000-1999 - ANNUAL SUPPORT & HOSTING TIER-2 NW-MB-AA-999-U-3YR - NETWRIX AUDITOR - ALL
AS-T2H-0010-0049 - ANNUAL SUPPORT & HOSTING TIER-2 NW-MS-AA-29999-U-3YR - NETWRIX AUDITOR - ALL
AS-T2H-0050-0099 - ANNUAL SUPPORT & HOSTING TIER-2 NW-JS-AA-999-U - NETWRIX AUDITOR - ALL
HRAUSERV1A5-M19 - ANNUAL SUPPORT AND MAINTENANCE FOR 7,501-8,000 IM USERS WITH 5 AUTHORIZED VIEWER NW-MB-AA-9999-U-3YR - NETWRIX AUDITOR - ALL
BKAV1-MAINT - ANNUAL SUPPORT AND MAINTENANCE FOR BUDDY LIST ADMINISTRATOR SERVER LICENSE. NW-MS-AA-4999-U-3YR - NETWRIX AUDITOR - ALL
AS-T2-0250-0499 - ANNUAL SUPPORT W/O HOSTING TIER-2 NW-MB-AA-29999-U-1YR - NETWRIX AUDITOR - ALL
AS-T2-0010-0049 - ANNUAL SUPPORT W/O HOSTING TIER-2 NW-MB-AA-29999-U-2YR - NETWRIX AUDITOR - ALL
AS-T2-0100-0249 - ANNUAL SUPPORT W/O HOSTING TIER-2 NW-MB-AA-29999-U-3YR - NETWRIX AUDITOR - ALL
AS-T2-0500-0999 - ANNUAL SUPPORT W/O HOSTING TIER-2 NW-MS-AA-149-FP-3YR - NETWRIX AUDITOR - ALL
AS-T2-2000-9999 - ANNUAL SUPPORT W/O HOSTING TIER-2 NW-MS-AA-9999-U-3YR - NETWRIX AUDITOR - ALL
AS-T2-1000-1999 - ANNUAL SUPPORT W/O HOSTING TIER-2 NW-P-AA-29999-U - NETWRIX AUDITOR - ALL
AS-T2-0050-0099 - ANNUAL SUPPORT W/O HOSTING TIER-2 NW-P-AA-999-U - NETWRIX AUDITOR - ALL
AS-T2-0001-0009 - ANNUAL SUPPORT W/O HOSTING TIER-2 NW-MS-AA-999-U-3YR - NETWRIX AUDITOR - ALL
RM000RSV05-50+ - ANNUAL UPGRADE SUBSCRIPTION NW-JS-AA-9999-U - NETWRIX AUDITOR - ALL
RM000RSV05 - ANNUAL UPGRADE SUBSCRIPTION NW-HC-AA-29999-U - NETWRIX AUDITOR - ALL
RM000RSV05-11-49 - ANNUAL UPGRADE SUBSCRIPTION NW-MB-AA-999-U-1YR-PS - NETWRIX AUDITOR - ALL
RM000PSV05 - ANNUAL UPGRADE SUBSCRIPTION FOR PAST DUE NW-MS-AA-29999-U-2YR-PS - NETWRIX AUDITOR - ALL
RM000PSV05-50+ - ANNUAL UPGRADE SUBSCRIPTION FOR PAST DUE NW-MS-AA-29999-U-3YR-PS - NETWRIX AUDITOR - ALL
RM000PSV05-11-49 - ANNUAL UPGRADE SUBSCRIPTION FOR PAST DUE NW-JS-AA-999-U-PS - NETWRIX AUDITOR - ALL
DOCTRNEU-AS-OS-01 - ANNUALAND UPDATES PACKAGE NW-JS-AA-149-FP-PS - NETWRIX AUDITOR - ALL
APA11R - APA- 1 PC - 1 YEAR MAINTENANCE RENEWAL NW-MB-AA-29999-U-1YR-PS - NETWRIX AUDITOR - ALL
APA21R - APA- 1 PC - 2 YEAR MAINTENANCE RENEWAL NW-MS-AA-999-U-2YR-PS - NETWRIX AUDITOR - ALL
APA31R - APA- 1 PC - 3 YEAR MAINTENANCE RENEWAL NW-MS-AA-9999-U-2YR-PS - NETWRIX AUDITOR - ALL
APA13R - APA- 3 PC - 1 YEAR MAINTENANCE RENEWAL NW-JS-AA-9999-U-PS - NETWRIX AUDITOR - ALL
APA23R - APA- 3 PC - 2 YEAR MAINTENANCE RENEWAL NW-MS-AA-4999-U-1YR-PS - NETWRIX AUDITOR - ALL
APA33R - APA- 3 PC - 3 YEAR MAINTENANCE RENEWAL NW-MB-AA-149-FP-2YR-PS - NETWRIX AUDITOR - ALL
APA15R - APA- 5 PC - 1 YEAR MAINTENANCE RENEWAL NW-MB-AA-999-U-2YR-PS - NETWRIX AUDITOR - ALL
APA25R - APA- 5 PC - 2 YEAR MAINTENANCE RENEWAL NW-MB-AA-4999-U-1YR-PS - NETWRIX AUDITOR - ALL
APA35R - APA- 5 PC - 3 YEAR MAINTENANCE RENEWAL NW-MB-AA-149-FP-3YR-PS - NETWRIX AUDITOR - ALL
MCT1174 - APD TOOLS N/AN/A1 YEARNOT SUPPORTED NW-MS-AA-9999-U-3YR-PS - NETWRIX AUDITOR - ALL
7015471-7016975-ENT - APP PROTECTION BY MOCANA FYM ENT SUP NW-MB-AA-9999-U-1YR-PS - NETWRIX AUDITOR - ALL
7015470-7016975-STD - APP PROTECTION BY MOCANA FYM STD SUP NW-MB-AA-29999-U-2YR-PS - NETWRIX AUDITOR - ALL
CPTS-DOC-MT-APPCTR - APPLICATION CONTROL TRAINING BLADE NW-MS-AA-4999-U-2YR-PS - NETWRIX AUDITOR - ALL
14FL1442 - APS DCF HAYES NUANCE APP DEVELOPMENT NW-MB-AA-4999-U-3YR-PS - NETWRIX AUDITOR - ALL
14FL1609 - APS DCF HAYES NUANCE TUNING NW-MS-AA-999-U-3YR-PS - NETWRIX AUDITOR - ALL
CF-SVCARB2CON1 - ARBITRATOR 360 NW-JS-AA-4999-U-PS - NETWRIX AUDITOR - ALL
CF-SVCARB2AMA1Y - ARBITRATOR360SW MAINTENANCE AGREEMENT-1Y NW-MS-AA-149-FP-1YR-PS - NETWRIX AUDITOR - ALL
CF-SVCARB2AMA2Y - ARBITRATOR360SW MAINTENANCE AGREEMENT-2Y NW-MS-AA-999-U-1YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-A-24-Y1 - ARCHIVE OPTIONA 24 MONTH YEAR 1 NW-MS-AA-149-FP-2YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-A-24-Y2 - ARCHIVE OPTIONA 24 MONTH YEAR 2 NW-MB-AA-999-U-3YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-A-36-Y1 - ARCHIVE OPTIONA 36 MONTH YEAR 1 NW-MB-AA-9999-U-3YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-A-36-Y2 - ARCHIVE OPTIONA 36 MONTH YEAR 2 NW-MS-AA-4999-U-3YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-A-36-Y3 - ARCHIVE OPTIONA 36 MONTH YEAR 3 NW-MB-AA-29999-U-3YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-B-24-Y1 - ARCHIVE OPTIONB 24 MONTH YEAR 1 NW-JS-AA-29999-U-PS - NETWRIX AUDITOR - ALL
21271948-27A-B-24-Y2 - ARCHIVE OPTIONB 24 MONTH YEAR 2 NW-MB-AA-149-FP-1YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-B-36-Y1 - ARCHIVE OPTIONB 36 MONTH YEAR 1 NW-MS-AA-9999-U-1YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-B-36-Y2 - ARCHIVE OPTIONB 36 MONTH YEAR 2 NW-MS-AA-29999-U-1YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-B-36-Y3 - ARCHIVE OPTIONB 36 MONTH YEAR 3 NW-MB-AA-4999-U-2YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-C-24-Y1 - ARCHIVE OPTIONC 24 MONTH YEAR 1 NW-MB-AA-9999-U-2YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-C-24-Y2 - ARCHIVE OPTIONC 24 MONTH YEAR 2 NW-MS-AA-149-FP-3YR-PS - NETWRIX AUDITOR - ALL
21271948-27A-C-36-Y1 - ARCHIVE OPTIONC 36 MONTH YEAR 1 NW-MS-AA-4999-U-1YR - NETWRIX AUDITOR - ALL
21271948-27A-C-36-Y2 - ARCHIVE OPTIONC 36 MONTH YEAR 2 NW-MB-AA-9999-U-2YR - NETWRIX AUDITOR - ALL
21271948-27A-C-36-Y3 - ARCHIVE OPTIONC 36 MONTH YEAR 3 NW-MS-AA-149-FP-2YR - NETWRIX AUDITOR - ALL
21271948-27A-D-24-Y1 - ARCHIVE OPTIOND 24 MONTH YEAR 1 NW-MS-AA-4999-U-2YR - NETWRIX AUDITOR - ALL
21271948-27A-D-24-Y2 - ARCHIVE OPTIOND 24 MONTH YEAR 2 NW-HC-AA-999-U - NETWRIX AUDITOR - ALL
21271948-27A-D-36-Y1 - ARCHIVE OPTIOND 36 MONTH YEAR 1 NW-HC-AA-4999-U - NETWRIX AUDITOR - ALL
21271948-27A-D-36-Y2 - ARCHIVE OPTIOND 36 MONTH YEAR 2 NW-P-AA-999-U-PS - NETWRIX AUDITOR - ALL
21271948-27A-D-36-Y3 - ARCHIVE OPTIOND 36 MONTH YEAR 3 NW-P-AA-9999-U-PS - NETWRIX AUDITOR - ALL
21271948-27A-E-24-Y1 - ARCHIVE OPTIONE 24 MONTH YEAR 1 NW-P-AA-149-FP-PS - NETWRIX AUDITOR - ALL
21271948-27A-E-24-Y2 - ARCHIVE OPTIONE 24 MONTH YEAR 2 NW-P-AA-29999-U-PS - NETWRIX AUDITOR - ALL
21271948-27A-E-36-Y1 - ARCHIVE OPTIONE 36 MONTH YEAR 1 NW-P-AA-9999-U - NETWRIX AUDITOR - ALL
21271948-27A-E-36-Y2 - ARCHIVE OPTIONE 36 MONTH YEAR 2 NW-P-AD-149-FP-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-E-36-Y3 - ARCHIVE OPTIONE 36 MONTH YEAR 3 NW-MB-AD-4999-U-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-F-24-Y1 - ARCHIVE OPTIONF 24 MONTH YEAR 1 NW-P-AD-4999-U-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-F-24-Y2 - ARCHIVE OPTIONF 24 MONTH YEAR 2 NW-P-AD-9999-U-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-F-36-Y1 - ARCHIVE OPTIONF 36 MONTH YEAR 1 NW-P-AD-29999-U-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-F-36-Y2 - ARCHIVE OPTIONF 36 MONTH YEAR 2 NW-P-AD-999-U-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-F-36-Y3 - ARCHIVE OPTIONF 36 MONTH YEAR 3 NW-MS-AD-999-U-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-G-24-Y1 - ARCHIVE OPTIONG 24 MONTH YEAR 1 NW-MS-AD-9999-U-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-G-24-Y2 - ARCHIVE OPTIONG 24 MONTH YEAR 2 NW-MS-AD-999-U-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-G-36-Y1 - ARCHIVE OPTIONG 36 MONTH YEAR 1 NW-MB-AD-29999-U-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-G-36-Y2 - ARCHIVE OPTIONG 36 MONTH YEAR 2 NW-MB-AD-149-FP-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21271948-27A-G-36-Y3 - ARCHIVE OPTIONG 36 MONTH YEAR 3 NW-MB-AD-29999-U-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
EWZONEUP2-AV2-10 - ARCVAULT 2U ZONE 2 UPLIFT 10 MONTHS NW-JS-AD-4999-U-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
7015471-7014367-ZSR - ASE ENTERPRISE EDITION- SERVER LICENSE NW-MB-AD-149-FP-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
7015471-7014367-ZST - ASE ENTERPRISE EDITION-NETWORKED SEAT NW-MB-AD-4999-U-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CDD09R1EC - ASM DISS HW SINGLESVR(D2D)/DT, V9 WIN NW-MB-AD-4999-U-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CVP09R1EC - ASM FOR ADD-ON VAL PACK, V9 WIN NW-MS-AD-9999-U-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CAT09R1EC - ASM FOR ADV TAPE SUPPORT, V9 WIN NW-JS-AD-149-FP-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CDT09R1EC - ASM FOR DESKTOP (PROFESSIONAL), V9 WIN NW-MB-AD-149-FP-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CDU09R1EC - ASM FOR DISS HW RSTR UNLIMITED, V9 WIN NW-MB-AD-999-U-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CEX09R1EC - ASM FOR EXCHANGE AGENT, V9 WIN NW-MB-AD-9999-U-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CSQ09R1EC - ASM FOR MS SQL AGENT, V9 WIN NW-MS-AD-4999-U-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CMS09R1EC - ASM FOR MULTI SERVER, V9 WIN NW-MB-AD-9999-U-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
COU09R1EC - ASM FOR OPEN FILE UNLIMITED, V9 WIN NW-JS-AD-999-U-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CSB09R1EC - ASM FOR SBS PREMIUM, V9 WIN NW-JS-AD-9999-U-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CSU09R1EC - ASM FOR SINGLE SERVER UNLIMITED, V9 WIN NW-MS-AD-999-U-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CS509R1EC - ASM FOR SINGLESVR(DISK-TO-DISK), V9 WIN NW-MS-AD-4999-U-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CVS09R1EC - ASM FOR VAL PACK FOR SBS, V9 WIN NW-MB-AD-149-FP-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
CVM09R1EC - ASM FOR VMWARE HOST AGENT, V9 WIN NW-JS-AD-149-FP - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
COD09R1EC - ASM OPEN FILE SINGLESVR(D2D), V9 WIN NW-MB-AD-999-U-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APSRTODE-REN - ASPOSE.TOTAL FOR REPORTING SERVICES DEVELOPER SMALL BUSINESS LICENSE RENEWAL NW-MB-AD-9999-U-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AAS3000 - ASSURED AVAILABILITY FTSERVICE NW-MS-AD-4999-U-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APL3000 - ASSURED AVAILABILITY PLUS FOR LINUX NW-MB-AD-9999-U-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APVM3000 - ASSURED AVAILABILITY PLUS FOR VMWARE NW-MB-AD-4999-U-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APS3000 - ASSURED AVAILABILITY PLUS FTSERVICE NW-JS-AD-4999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AT-2711FX/LC-901-NCA3 - AT-2711FX/LC-901 NET.COVER ADVANCED SUPPORT THREE YEAR NW-HC-AD-29999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AT-8000GS/24-10-NCS-1 - AT-8000GS/24-10 NET COVER STANDARD SUPPORT 1 YEAR NW-MS-AD-149-FP-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AT-8000GS/48-10-NCS-1 - AT-8000GS/48-10 NET COVER STANDARD SUPPORT 1 YEAR NW-MS-AD-29999-U-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AT-9000/52-10-NCS-1 - AT-9000/52-10 NET COVER STANDARD SUPPORT 1 YEAR NW-MS-AD-149-FP-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AT-STACKXS/1.0-NCA1 - AT-STACKXS/1.0 NET.COVER ADVANCED SUPPORT ONE YEAR NW-JS-AD-999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AT-X510-28GSX-NCA1 - AT-X510-28GSX NET.COVER ADVANCED SUPPORT ONE YEAR NW-HC-AD-4999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
FC-10-01006-915-02-12 - ATP BUNDLE (1 YEAR 24X7 FORTICARE PLUS AV AND WEB FILTERING SERVICES) NW-P-AD-9999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
FC-10-01006-915-02-24 - ATP BUNDLE (2 YEARS 24X7 FORTICARE PLUS AV AND WEB FILTERING SERVICES) NW-P-AD-999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
FC-10-01006-915-02-36 - ATP BUNDLE (3 YEARS 24X7 FORTICARE PLUS AV AND WEB FILTERING SERVICES) NW-P-AD-149-FP - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AVES3000 - AVANCE SOFTWARE SUPPORT 1 YEAR PRE-PAY NW-P-AD-4999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AESS210001999NPER - AVAST EML SVR SEC 2 YR 1000-1999 NPE RNW NW-P-AD-29999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
AESS220004999NPER - AVAST EML SVR SEC 2 YR 2000-4999 NPE RNW NW-MB-AD-149-FP-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA11NPER - AVAST PRO ANTIVIRUS 1 PC 1 YEAR MAINTENANCE NW-MB-AD-4999-U-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA21NPER - AVAST PRO ANTIVIRUS 1 PC 2 YEAR MAINTENANCE NW-MS-AD-9999-U-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA31NPER - AVAST PRO ANTIVIRUS 1 PC 3 YEAR MAINTENANCE NW-MB-AD-29999-U-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA13NPER - AVAST PRO ANTIVIRUS 3 PC 1 YEAR MAINTENANCE NW-JS-AD-9999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA23NPER - AVAST PRO ANTIVIRUS 3 PC 2 YEAR MAINTENANCE NW-HC-AD-9999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA33NPER - AVAST PRO ANTIVIRUS 3 PC 3 YEAR MAINTENANCE NW-HC-AD-999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA15NPER - AVAST PRO ANTIVIRUS 5 PC 1 YEAR MAINTENANCE NW-MS-AD-29999-U-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA25NPER - AVAST PRO ANTIVIRUS 5 PC 2 YEAR MAINTENANCE NW-MS-AD-149-FP-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
APA35NPER - AVAST PRO ANTIVIRUS 5 PC 3 YEAR MAINTENANCE NW-MB-AD-29999-U-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
5S2-00004 - AZURESUBSSRVCESOPN SHRDSVR ALNG SUBSVL OLV D 1MTH AP NW-MS-AD-29999-U-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
5S2-00001 - AZURESUBSSRVCESOPN SHRDSVR ALNG SUBSVL OLV NL 1MTH AP NW-MB-AD-29999-U-1YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
7008441-7015939-ENT - BA&T SAP DQM EDGE EDITION TO DATA SERVICES UPGRADE, EDGE EDITION UPGRADE FYM ENT NW-MB-AD-149-FP-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-A-12 - BAND A 12 MONTH NW-MB-AD-999-U-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-A-24-Y1 - BAND A 24 MONTH NW-MB-AD-9999-U-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-A-24-Y2 - BAND A 24 MONTH NW-MS-AD-4999-U-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-A-36-Y1 - BAND A 36 MONTH NW-HC-AD-149-FP - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-A-36-Y2 - BAND A 36 MONTH NW-MB-AD-4999-U-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-A-36-Y3 - BAND A 36 MONTH NW-MS-AD-9999-U-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-B-12 - BAND B 12 MONTH NW-MS-AD-999-U-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-B-24-Y1 - BAND B 24 MONTH NW-MB-AD-999-U-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-B-24-Y2 - BAND B 24 MONTH NW-MS-AD-999-U-2YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-B-36-Y2 - BAND B 36 MONTH NW-MS-AD-9999-U-3YR - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-B-36-Y1 - BAND B 36 MONTH NW-JS-AD-29999-U - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-B-36-Y3 - BAND B 36 MONTH NW-MB-AD-29999-U-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-C-12 - BAND C 12 MONTH NW-MS-AD-149-FP-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-C-24-Y2 - BAND C 24 MONTH NW-MS-AD-29999-U-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-C-24-Y1 - BAND C 24 MONTH NW-MB-AD-9999-U-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-C-36-Y1 - BAND C 36 MONTH NW-MS-AD-149-FP-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-C-36-Y3 - BAND C 36 MONTH NW-MS-AD-999-U-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-C-36-Y2 - BAND C 36 MONTH NW-MB-AD-999-U-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-D-12 - BAND D 12 MONTH NW-MS-AD-9999-U-2YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-D-24-Y1 - BAND D 24 MONTH NW-MS-AD-149-FP-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-D-24-Y2 - BAND D 24 MONTH NW-JS-AD-29999-U-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-D-36-Y2 - BAND D 36 MONTH NW-MS-AD-4999-U-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-D-36-Y3 - BAND D 36 MONTH NW-MS-AD-29999-U-1YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-D-36-Y1 - BAND D 36 MONTH NW-MB-AD-999-U-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-E-12 - BAND E 12 MONTH NW-MS-AD-4999-U-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-E-24-Y1 - BAND E 24 MONTH NW-MS-AD-29999-U-3YR-PS - NETWRIX AUDITOR FOR ACTIVE DIRECTORY
21210958-28A-E-24-Y2 - BAND E 24 MONTH NW-MS-EX-149-FP-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-E-36-Y3 - BAND E 36 MONTH NW-MS-EX-4999-U-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-E-36-Y1 - BAND E 36 MONTH NW-MB-EX-29999-U-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-E-36-Y2 - BAND E 36 MONTH NW-MS-EX-9999-U-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-F-12 - BAND F 12 MONTH NW-MS-EX-9999-U-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-F-24-Y1 - BAND F 24 MONTH NW-JS-EX-149-FP-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-F-24-Y2 - BAND F 24 MONTH NW-MB-EX-4999-U-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-F-36-Y1 - BAND F 36 MONTH NW-MB-EX-149-FP-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-F-36-Y2 - BAND F 36 MONTH NW-MB-EX-29999-U-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-F-36-Y3 - BAND F 36 MONTH NW-P-EX-999-U-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-G-12 - BAND G 12 MONTH NW-P-EX-29999-U-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-G-24-Y2 - BAND G 24 MONTH NW-MS-EX-149-FP-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-G-24-Y1 - BAND G 24 MONTH NW-MS-EX-4999-U-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-G-36-Y3 - BAND G 36 MONTH NW-MS-EX-29999-U-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-G-36-Y2 - BAND G 36 MONTH NW-MS-EX-29999-U-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
21210958-28A-G-36-Y1 - BAND G 36 MONTH NW-MB-EX-9999-U-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
DOCARCHSRVC-BW - BASE NW-MB-EX-9999-U-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
WNBWN002 - BASE - 2 YEAR SOFTWARE SUPPORT CONTRACT NW-MB-EX-999-U-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
NBWN0002 - BASE - 2 YEAR SOFTWARE SUPPORT CONTRACT NW-JS-EX-29999-U-PS - NETWRIX AUDITOR FOR EXCHANGE
NBWN0001 - BASE - 2 YEAR SOFTWARE SUPPORT CONTRACT NW-MB-EX-29999-U-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
WNBWN001 - BASE - 2 YEAR SOFTWARE SUPPORT CONTRACT (NBWL0355/NBWL0455) NW-MS-EX-999-U-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
902116-86 - BASE HW SVCS 5X10 BUS HRS RET TO DEPOT A NW-MS-EX-29999-U-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
SVC-BLR-PRI-STD - BASE LABOR RATE - PRINCIPAL RESOURCE NW-MS-EX-149-FP-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
SVC-BLR-SNR-STD - BASE LABOR RATE - SENIOR RESOURCE NW-JS-EX-999-U-PS - NETWRIX AUDITOR FOR EXCHANGE
SVC-BLR-SNR-EDU - BASE LABOR RATE - SENIOR RESOURCE NW-P-EX-999-U - NETWRIX AUDITOR FOR EXCHANGE
SVC-BLR-STD-STD - BASE LABOR RATE - STANDARD RESOURCE NW-MS-EX-4999-U-1YR - NETWRIX AUDITOR FOR EXCHANGE
SVC-BLR-STD-EDU - BASE LABORRATE-STND RESOURCE-EDUCATIONAL NW-MS-EX-4999-U-2YR - NETWRIX AUDITOR FOR EXCHANGE
DOCARCHSRVC-10GIG - BASE PERGIGABYTE MONTHLY FEE NW-MS-EX-999-U-3YR - NETWRIX AUDITOR FOR EXCHANGE
DSSETUP - BASIC DIGITAL SIGNAGE SETUP NW-P-EX-29999-U - NETWRIX AUDITOR FOR EXCHANGE
20014290 - BCS ADV ACS ADDL CNTCT F BE PROD FAM NW-MB-EX-149-FP-1YR - NETWRIX AUDITOR FOR EXCHANGE
20014268 - BCS ADV ACS ADDL CNTCT F CCS PROD FAM NW-MS-EX-999-U-1YR - NETWRIX AUDITOR FOR EXCHANGE
20014251 - BCS ADV ACS ADDL CNTCT F NBU PROD FAM NW-MB-EX-149-FP-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014275 - BCS ADV ACS ADDL CNTCT F SNAC PROD FAM NW-JS-EX-4999-U - NETWRIX AUDITOR FOR EXCHANGE
20014235 - BCS ADV ACS ADDL CNTCTFENT VLT PROD FAM NW-MS-EX-9999-U-1YR - NETWRIX AUDITOR FOR EXCHANGE
20014285 - BCS ADV ACS F BE PROD FAM NW-MB-EX-149-FP-2YR - NETWRIX AUDITOR FOR EXCHANGE
20014291 - BCS ADV ACS F CCS PROD FAM NW-HC-EX-999-U - NETWRIX AUDITOR FOR EXCHANGE
20014267 - BCS ADV ACS F CMMND CNTRL PROD FAM NW-MB-EX-9999-U-1YR - NETWRIX AUDITOR FOR EXCHANGE
20014250 - BCS ADV ACS F CNTNT FLTR & AS PROD FAM NW-MB-EX-29999-U-1YR - NETWRIX AUDITOR FOR EXCHANGE
20014292 - BCS ADV ACS F ENDPNT SCRTY PROD FAM NW-MB-EX-999-U-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014244 - BCS ADV ACS F ENT VLT PROD FAM NW-MB-EX-29999-U-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014259 - BCS ADV ACS F INTRSN PRO PROD FAM NW-MS-EX-9999-U-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014260 - BCS ADV ACS F NBU PROD FAM NW-MS-EX-29999-U-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014276 - BCS ADV ACS F SNAC PROD FAM NW-MB-EX-999-U-1YR - NETWRIX AUDITOR FOR EXCHANGE
20014281 - BCS ADV ACS F SRVR MGMT PROD FAM NW-MS-EX-149-FP-1YR - NETWRIX AUDITOR FOR EXCHANGE
20014271 - BCS ADV ACS F STRG FNDTN PROD FAM NW-MB-EX-4999-U-2YR - NETWRIX AUDITOR FOR EXCHANGE
20014295 - BCS ADV ACS F STRG MGMT PROD FAM NW-MB-EX-29999-U-2YR - NETWRIX AUDITOR FOR EXCHANGE
20014274 - BCS ENT VAULT FMLY RMTE PRDCT SPCLST NW-MS-EX-149-FP-2YR - NETWRIX AUDITOR FOR EXCHANGE
20014240 - BCS GHOST FMLY DCTD RMTE PRDCT SPCLST NW-JS-EX-999-U - NETWRIX AUDITOR FOR EXCHANGE
20014296 - BCS NTBCK FMLY DCTD RMTE PRDCT SPCLST NW-JS-EX-9999-U - NETWRIX AUDITOR FOR EXCHANGE
20014241 - BCS NTBCK FMLY RMTE PRDCT SPCLST NW-HC-EX-4999-U - NETWRIX AUDITOR FOR EXCHANGE
20014252 - BCS ONE ONSITE VISIT NW-HC-EX-29999-U - NETWRIX AUDITOR FOR EXCHANGE
20014266 - BCS PCA FMLY DCTD RMTE PRDCT SPCLST NW-MB-EX-9999-U-2YR - NETWRIX AUDITOR FOR EXCHANGE
20014253 - BCS STRGE FNDTN&CLSTRNG FMLY ADDL CNTCT NW-MS-EX-999-U-2YR - NETWRIX AUDITOR FOR EXCHANGE
20014258 - BCSADVACSADDLCNTCTFCMMNDCNTRLPRODFAM NW-MS-EX-9999-U-2YR - NETWRIX AUDITOR FOR EXCHANGE
20014293 - BCSADVACSADDLCNTCTFCNTNTFLTR&ASPRODFAM NW-MB-EX-9999-U-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014255 - BCSADVACSADDLCNTCTFENDPNTSCRTYPRODFAM NW-MS-EX-149-FP-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014249 - BCSADVACSADDLCNTCTFINTRSNPROPRODFAM NW-JS-EX-29999-U - NETWRIX AUDITOR FOR EXCHANGE
20014277 - BCSADVACSADDLCNTCTFSRVRMGMTPRODFAM NW-HC-EX-9999-U - NETWRIX AUDITOR FOR EXCHANGE
20014262 - BCSADVACSADDLCNTCTFSTRGFNDTNPRODFAM NW-MB-EX-4999-U-1YR - NETWRIX AUDITOR FOR EXCHANGE
20014272 - BCSADVACSADDLCNTCTFSTRGMGMTPRODFAM NW-MS-EX-29999-U-2YR - NETWRIX AUDITOR FOR EXCHANGE
20014284 - BCSALTIRIS ENDPNT MNGMNT FMLY ADDL CNTCT NW-MB-EX-4999-U-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014288 - BCSALTIRISENDPNTMNGMNTFMLYDCTDRMTEPRDCT NW-MS-EX-4999-U-3YR - NETWRIX AUDITOR FOR EXCHANGE
20014278 - BCSALTIRISENDPNTMNGMNTFMLYRMTEPRDCTSPCL NW-JS-EX-149-FP - NETWRIX AUDITOR FOR EXCHANGE
20014286 - BCSBACKUPEXECFMLYDCTDRMTEPRDCTSPCLST NW-P-EX-4999-U - NETWRIX AUDITOR FOR EXCHANGE
20014246 - BCSBACKUPEXECSYSRCVRYFMLYDCTDRMTEPRDCTS NW-P-EX-149-FP - NETWRIX AUDITOR FOR EXCHANGE
20014247 - BCSCNTNTFLTRNG&ANTISPAMFMLYDCTDRMTEPRDC NW-P-EX-9999-U - NETWRIX AUDITOR FOR EXCHANGE
20014283 - BCSCNTRLCMPLNCSTEFMLYDCTDRMTEPRDCTSPCLS NW-P-EX-149-FP-PS - NETWRIX AUDITOR FOR EXCHANGE
20014289 - BCSDLVRY&DSCVRYFMLYDCTDRMTEPRDCTSPCLST NW-MB-EX-999-U-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014237 - BCSENDPNTCMPLNCFMLYDCTDRMTEPRDCTSPCLST NW-MS-EX-9999-U-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014238 - BCSENDPNTPRTCTNFMLYDCTDRMTEPRDCTSPCLST NW-MB-EX-999-U-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014265 - BCSENTVAULTFMLYADDLCNTCTRMTEPRDCTSPCLST NW-MB-EX-9999-U-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014273 - BCSENTVAULTFMLYDCTDRMTEPRDCTSPCLST NW-JS-EX-4999-U-PS - NETWRIX AUDITOR FOR EXCHANGE
20014256 - BCSINTRSNDTCTN&PREVNTNFMLYDCTDRMTEPRDCT NW-MB-EX-149-FP-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014263 - BCSNTBCKFMLYADDLCNTCTRMTEPRDCTSPCLST NW-MB-EX-4999-U-1YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014297 - BCSSCRTYMNGMNTFMLYDCTDRMTEPRDCTSPCLST NW-MB-EX-149-FP-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014254 - BCSSTRGEFNDTN&CLSTRNGFMLYDCTDRMTEPRDCTS NW-MS-EX-999-U-2YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014264 - BCSSTRGEFNDTN&CLSTRNGFMLYRMTEPRDCTSPCLS NW-MB-EX-4999-U-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
20014279 - BCSVLNRBLTYMNGMNTFMLYDCTDRMTEPRDCTSPCLS NW-MS-EX-999-U-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
7015884-7017694-ENT - BI PLATFORM (CS) FYM ENT SUPPORT NW-P-EX-9999-U-PS - NETWRIX AUDITOR FOR EXCHANGE
7015886-7017694-STD - BI PLATFORM (CS) FYM STD SUPPORT NW-P-EX-4999-U-PS - NETWRIX AUDITOR FOR EXCHANGE
7015884-7017693-ENT - BI PLATFORM (USER) FYM ENT SUPPORT NW-MS-EX-29999-U-1YR - NETWRIX AUDITOR FOR EXCHANGE
7015886-7017693-STD - BI PLATFORM (USER) FYM STD SUPPORT NW-MB-EX-999-U-2YR - NETWRIX AUDITOR FOR EXCHANGE
7008441-7017689-ENT - BI SUITE (CS) FYM ENT SUPPORT NW-HC-EX-149-FP - NETWRIX AUDITOR FOR EXCHANGE
7010282-7017689-STD - BI SUITE (CS) FYM STD SUPPORT NW-MS-EX-4999-U-3YR-PS - NETWRIX AUDITOR FOR EXCHANGE
7008441-7017688-ENT - BI SUITE (USER) FYM ENT SUPPORT NW-JS-EX-9999-U-PS - NETWRIX AUDITOR FOR EXCHANGE
7010282-7017688-STD - BI SUITE (USER) FYM STD SUPPORT NW-MS-FS-999-U-2YR - NETWRIX AUDITOR FOR FILE SERVER
7015884-7017690-ENT - BI SUITE ANALYTICS EDITIONFYM ENT SUPRT NW-MS-FS-29999-U-2YR - NETWRIX AUDITOR FOR FILE SERVER
7015886-7017690-STD - BI SUITE ANALYTICS EDITIONFYM STD SUPRT NW-HC-FS-999-U - NETWRIX AUDITOR FOR FILE SERVER
7008441-7017711-ENT - BI, EDGE EDITION (USER) FYM ENT SUPPORT NW-P-FS-149-FP-PS - NETWRIX AUDITOR FOR FILE SERVER
7010282-7017711-STD - BI, EDGE EDITION (USER) FYM STD SUPPORT NW-P-FS-999-U-PS - NETWRIX AUDITOR FOR FILE SERVER
7008441-7017715-ENT - BI, EDGE EDITION (CS) FYM ENT SUPPORT NW-P-FS-4999-U-PS - NETWRIX AUDITOR FOR FILE SERVER
7010282-7017715-STD - BI, EDGE EDITION (CS) FYM STD SUPPORT NW-MB-FS-29999-U-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-A-12 - BLACKBERRY OPTIONA 12 MONTH NW-MS-FS-999-U-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-A-24-Y2 - BLACKBERRY OPTIONA 24 MONTH NW-MS-FS-4999-U-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-A-24-Y1 - BLACKBERRY OPTIONA 24 MONTH NW-MB-FS-4999-U-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-A-24-Y1 - BLACKBERRY OPTIONA 24 MONTH YEAR 1 NW-JS-FS-149-FP-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-A-24-Y2 - BLACKBERRY OPTIONA 24 MONTH YEAR 2 NW-MB-FS-9999-U-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-A-36-Y1 - BLACKBERRY OPTIONA 36 MONTH NW-MB-FS-4999-U-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-A-36-Y2 - BLACKBERRY OPTIONA 36 MONTH NW-MS-FS-29999-U-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-A-36-Y3 - BLACKBERRY OPTIONA 36 MONTH NW-MS-FS-149-FP-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-A-36-Y1 - BLACKBERRY OPTIONA 36 MONTH YEAR 1 NW-MS-FS-4999-U-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-A-36-Y2 - BLACKBERRY OPTIONA 36 MONTH YEAR 2 NW-MS-FS-29999-U-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-A-36-Y3 - BLACKBERRY OPTIONA 36 MONTH YEAR 3 NW-MS-FS-999-U-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-B-12 - BLACKBERRY OPTIONB 12 MONTH NW-MS-FS-9999-U-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-B-24-Y1 - BLACKBERRY OPTIONB 24 MONTH NW-MB-FS-29999-U-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-B-24-Y2 - BLACKBERRY OPTIONB 24 MONTH NW-MB-FS-9999-U-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-B-24-Y1 - BLACKBERRY OPTIONB 24 MONTH YEAR 1 NW-MS-FS-149-FP-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-B-24-Y2 - BLACKBERRY OPTIONB 24 MONTH YEAR 2 NW-P-FS-9999-U-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-B-36-Y1 - BLACKBERRY OPTIONB 36 MONTH NW-P-FS-149-FP - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-B-36-Y3 - BLACKBERRY OPTIONB 36 MONTH NW-MS-FS-149-FP-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-B-36-Y2 - BLACKBERRY OPTIONB 36 MONTH NW-MB-FS-4999-U-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-B-36-Y1 - BLACKBERRY OPTIONB 36 MONTH YEAR 1 NW-MS-FS-9999-U-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-B-36-Y2 - BLACKBERRY OPTIONB 36 MONTH YEAR 2 NW-MS-FS-29999-U-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-B-36-Y3 - BLACKBERRY OPTIONB 36 MONTH YEAR 3 NW-P-FS-999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-C-12 - BLACKBERRY OPTIONC 12 MONTH NW-P-FS-4999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-C-24-Y1 - BLACKBERRY OPTIONC 24 MONTH NW-MB-FS-999-U-2YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-C-24-Y2 - BLACKBERRY OPTIONC 24 MONTH NW-MB-FS-149-FP-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-C-24-Y1 - BLACKBERRY OPTIONC 24 MONTH YEAR 1 NW-MB-FS-149-FP-2YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-C-24-Y2 - BLACKBERRY OPTIONC 24 MONTH YEAR 2 NW-MB-FS-4999-U-2YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-C-36-Y3 - BLACKBERRY OPTIONC 36 MONTH NW-MB-FS-29999-U-2YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-C-36-Y1 - BLACKBERRY OPTIONC 36 MONTH NW-MB-FS-999-U-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-C-36-Y2 - BLACKBERRY OPTIONC 36 MONTH NW-JS-FS-9999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-C-36-Y1 - BLACKBERRY OPTIONC 36 MONTH YEAR 1 NW-HC-FS-9999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-C-36-Y2 - BLACKBERRY OPTIONC 36 MONTH YEAR 2 NW-MB-FS-9999-U-2YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-C-36-Y3 - BLACKBERRY OPTIONC 36 MONTH YEAR 3 NW-MS-FS-4999-U-2YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-D-12 - BLACKBERRY OPTIOND 12 MONTH NW-HC-FS-149-FP - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-D-24-Y1 - BLACKBERRY OPTIOND 24 MONTH NW-HC-FS-4999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-D-24-Y2 - BLACKBERRY OPTIOND 24 MONTH NW-MB-FS-29999-U-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-D-24-Y1 - BLACKBERRY OPTIOND 24 MONTH YEAR 1 NW-MS-FS-4999-U-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-D-24-Y2 - BLACKBERRY OPTIOND 24 MONTH YEAR 2 NW-JS-FS-149-FP - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-D-36-Y1 - BLACKBERRY OPTIOND 36 MONTH NW-MB-FS-149-FP-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-D-36-Y3 - BLACKBERRY OPTIOND 36 MONTH NW-MS-FS-149-FP-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-D-36-Y2 - BLACKBERRY OPTIOND 36 MONTH NW-JS-FS-4999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-D-36-Y1 - BLACKBERRY OPTIOND 36 MONTH YEAR 1 NW-JS-FS-29999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-D-36-Y2 - BLACKBERRY OPTIOND 36 MONTH YEAR 2 NW-HC-FS-29999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-D-36-Y3 - BLACKBERRY OPTIOND 36 MONTH YEAR 3 NW-MB-FS-9999-U-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-E-12 - BLACKBERRY OPTIONE 12 MONTH NW-MS-FS-4999-U-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-E-24-Y2 - BLACKBERRY OPTIONE 24 MONTH NW-MS-FS-29999-U-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-E-24-Y1 - BLACKBERRY OPTIONE 24 MONTH NW-MB-FS-9999-U-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-E-24-Y1 - BLACKBERRY OPTIONE 24 MONTH YEAR 1 NW-MS-FS-999-U-3YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-E-24-Y2 - BLACKBERRY OPTIONE 24 MONTH YEAR 2 NW-JS-FS-999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-E-36-Y2 - BLACKBERRY OPTIONE 36 MONTH NW-P-FS-9999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-E-36-Y1 - BLACKBERRY OPTIONE 36 MONTH NW-MB-FS-4999-U-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-E-36-Y3 - BLACKBERRY OPTIONE 36 MONTH NW-MB-FS-29999-U-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-E-36-Y1 - BLACKBERRY OPTIONE 36 MONTH YEAR 1 NW-MS-FS-9999-U-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-E-36-Y2 - BLACKBERRY OPTIONE 36 MONTH YEAR 2 NW-P-FS-29999-U - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-E-36-Y3 - BLACKBERRY OPTIONE 36 MONTH YEAR 3 NW-MB-FS-999-U-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-F-12 - BLACKBERRY OPTIONF 12 MONTH NW-MS-FS-999-U-1YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-F-24-Y1 - BLACKBERRY OPTIONF 24 MONTH NW-MS-FS-149-FP-2YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-F-24-Y2 - BLACKBERRY OPTIONF 24 MONTH NW-MS-FS-9999-U-2YR - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-F-24-Y1 - BLACKBERRY OPTIONF 24 MONTH YEAR 1 NW-MB-FS-149-FP-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-F-24-Y2 - BLACKBERRY OPTIONF 24 MONTH YEAR 2 NW-MB-FS-999-U-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-F-36-Y1 - BLACKBERRY OPTIONF 36 MONTH NW-MB-FS-999-U-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-F-36-Y2 - BLACKBERRY OPTIONF 36 MONTH NW-MB-FS-999-U-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-F-36-Y3 - BLACKBERRY OPTIONF 36 MONTH NW-MB-FS-4999-U-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-F-36-Y1 - BLACKBERRY OPTIONF 36 MONTH YEAR 1 NW-MS-FS-149-FP-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-F-36-Y2 - BLACKBERRY OPTIONF 36 MONTH YEAR 2 NW-MS-FS-9999-U-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-F-36-Y3 - BLACKBERRY OPTIONF 36 MONTH YEAR 3 NW-MB-FS-149-FP-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-G-12 - BLACKBERRY OPTIONG 12 MONTH NW-MB-FS-29999-U-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-G-24-Y1 - BLACKBERRY OPTIONG 24 MONTH NW-MS-FS-9999-U-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-G-24-Y2 - BLACKBERRY OPTIONG 24 MONTH NW-MS-FS-4999-U-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-G-24-Y1 - BLACKBERRY OPTIONG 24 MONTH YEAR 1 NW-MS-FS-29999-U-3YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-G-24-Y2 - BLACKBERRY OPTIONG 24 MONTH YEAR 2 NW-JS-FS-4999-U-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-G-36-Y1 - BLACKBERRY OPTIONG 36 MONTH NW-JS-FS-29999-U-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-G-36-Y3 - BLACKBERRY OPTIONG 36 MONTH NW-P-FS-29999-U-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-28A-G-36-Y2 - BLACKBERRY OPTIONG 36 MONTH NW-JS-FS-999-U-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-G-36-Y1 - BLACKBERRY OPTIONG 36 MONTH YEAR 1 NW-JS-FS-9999-U-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-G-36-Y2 - BLACKBERRY OPTIONG 36 MONTH YEAR 2 NW-MB-FS-9999-U-1YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210991-27A-G-36-Y3 - BLACKBERRY OPTIONG 36 MONTH YEAR 3 NW-MB-FS-149-FP-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210990-27A-A-24-Y1 - BLOOMBERGBAND A 24 MONTH YEAR 1 NW-MS-FS-999-U-2YR-PS - NETWRIX AUDITOR FOR FILE SERVER
21210990-27A-A-24-Y2 - BLOOMBERGBAND A 24 MONTH YEAR 2 NW-P-IU-149-FP-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-A-36-Y1 - BLOOMBERGBAND A 36 MONTH YEAR 1 NW-P-IU-4999-U-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-A-36-Y2 - BLOOMBERGBAND A 36 MONTH YEAR 2 NW-P-IU-9999-U-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-A-36-Y3 - BLOOMBERGBAND A 36 MONTH YEAR 3 NW-P-IU-9999-U - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-B-24-Y1 - BLOOMBERGBAND B 24 MONTH YEAR 1 NW-P-IU-29999-U - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-B-24-Y2 - BLOOMBERGBAND B 24 MONTH YEAR 2 NW-MB-IU-9999-U-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-B-36-Y1 - BLOOMBERGBAND B 36 MONTH YEAR 1 NW-MS-IU-149-FP-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-B-36-Y2 - BLOOMBERGBAND B 36 MONTH YEAR 2 NW-MS-IU-999-U-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-B-36-Y3 - BLOOMBERGBAND B 36 MONTH YEAR 3 NW-MS-IU-29999-U-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-C-24-Y1 - BLOOMBERGBAND C 24 MONTH YEAR 1 NW-MS-IU-149-FP-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-C-24-Y2 - BLOOMBERGBAND C 24 MONTH YEAR 2 NW-MS-IU-999-U-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-C-36-Y1 - BLOOMBERGBAND C 36 MONTH YEAR 1 NW-MB-IU-29999-U-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-C-36-Y2 - BLOOMBERGBAND C 36 MONTH YEAR 2 NW-MS-IU-999-U-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-C-36-Y3 - BLOOMBERGBAND C 36 MONTH YEAR 3 NW-JS-IU-4999-U-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-D-24-Y1 - BLOOMBERGBAND D 24 MONTH YEAR 1 NW-MB-IU-149-FP-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-D-24-Y2 - BLOOMBERGBAND D 24 MONTH YEAR 2 NW-MB-IU-9999-U-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-D-36-Y1 - BLOOMBERGBAND D 36 MONTH YEAR 1 NW-MS-IU-149-FP-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-D-36-Y2 - BLOOMBERGBAND D 36 MONTH YEAR 2 NW-MB-IU-4999-U-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-D-36-Y3 - BLOOMBERGBAND D 36 MONTH YEAR 3 NW-MB-IU-29999-U-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-E-24-Y1 - BLOOMBERGBAND E 24 MONTH YEAR 1 NW-MB-IU-29999-U-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-E-24-Y2 - BLOOMBERGBAND E 24 MONTH YEAR 2 NW-MS-IU-999-U-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-E-36-Y1 - BLOOMBERGBAND E 36 MONTH YEAR 1 NW-P-IU-149-FP - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-E-36-Y2 - BLOOMBERGBAND E 36 MONTH YEAR 2 NW-P-IU-999-U - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-E-36-Y3 - BLOOMBERGBAND E 36 MONTH YEAR 3 NW-MB-IU-149-FP-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-F-24-Y1 - BLOOMBERGBAND F 24 MONTH YEAR 1 NW-MB-IU-999-U-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-F-24-Y2 - BLOOMBERGBAND F 24 MONTH YEAR 2 NW-MS-IU-149-FP-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-F-36-Y1 - BLOOMBERGBAND F 36 MONTH YEAR 1 NW-MS-IU-9999-U-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-F-36-Y2 - BLOOMBERGBAND F 36 MONTH YEAR 2 NW-JS-IU-149-FP-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-F-36-Y3 - BLOOMBERGBAND F 36 MONTH YEAR 3 NW-JS-IU-9999-U-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-G-24-Y1 - BLOOMBERGBAND G 24 MONTH YEAR 1 NW-MS-IU-29999-U-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-G-24-Y2 - BLOOMBERGBAND G 24 MONTH YEAR 2 NW-MB-IU-4999-U-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-G-36-Y1 - BLOOMBERGBAND G 36 MONTH YEAR 1 NW-MB-IU-29999-U-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-G-36-Y2 - BLOOMBERGBAND G 36 MONTH YEAR 2 NW-MB-IU-4999-U-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210990-27A-G-36-Y3 - BLOOMBERGBAND G 36 MONTH YEAR 3 NW-P-IU-4999-U - NETWRIX AUDITOR FOR INACTIVE USERS
1361 - BLUEBEAM STUDIO SERVER MAINTENANCE - RENEWAL PRICE PER SERVER (OPTIONAL AFTER 1 NW-MB-IU-149-FP-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-A-12 - BOUNDARY ENCRYPTION BAND A 12 MONTH NW-MB-IU-999-U-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-A-24-Y1 - BOUNDARY ENCRYPTION BAND A 24 MONTH YR1 NW-MB-IU-9999-U-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-B-12 - BOUNDARY ENCRYPTION BAND B 12 MONTH NW-MS-IU-9999-U-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-B-24-Y1 - BOUNDARY ENCRYPTION BAND B 24 MONTH YR1 NW-MB-IU-149-FP-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-C-12 - BOUNDARY ENCRYPTION BAND C 12 MONTH NW-MB-IU-9999-U-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-C-24-Y1 - BOUNDARY ENCRYPTION BAND C 24 MONTH YR1 NW-MB-IU-29999-U-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-D-12 - BOUNDARY ENCRYPTION BAND D 12 MONTH NW-MS-IU-4999-U-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-D-24-Y1 - BOUNDARY ENCRYPTION BAND D 24 MONTH YR1 NW-MB-IU-4999-U-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-E-12 - BOUNDARY ENCRYPTION BAND E 12 MONTH NW-MS-IU-4999-U-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-E-24-Y1 - BOUNDARY ENCRYPTION BAND E 24 MONTH YR1 NW-MS-IU-29999-U-2YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-F-12 - BOUNDARY ENCRYPTION BAND F 12 MONTH NW-JS-IU-999-U-PS - NETWRIX AUDITOR FOR INACTIVE USERS
21210958-26A-F-24-Y1 - BOUNDARY ENCRYPTION BAND F 24 MONTH YR1 NW-JS-IU-29999-U-PS - NETWRIX AUDITOR FOR INACTIVE USERS
GMRBABLB10S16CG - BrightStor ARCserve Backup r11.5 for Linux Disk Staging Option -Maintenance Rene NW-MS-IU-4999-U-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
GMRBABLB10S16CJ - BrightStor ARCserve Backup r11.5 for Linux Disk Staging Option -Maintenance Rene NW-MS-IU-9999-U-1YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZ2B - BRONZE FOR PRO 1YR BUNDLE LVL B 1029 NW-MB-IU-999-U-3YR-PS - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZ3C - BRONZE FOR PRO 1YR BUNDLE LVL C 3099 NW-HC-IU-29999-U - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZ4D - BRONZE FOR PRO 1YR BUNDLE LVL D 100499 NW-HC-IU-999-U - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZ5E - BRONZE FOR PRO 1YR BUNDLE LVL E 500+ NW-MS-IU-29999-U-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZ1TB - BRONZE FOR PRO 1YR LATE ADD LVL B 1029 NW-MS-IU-9999-U-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZ1TC - BRONZE FOR PRO 1YR LATE ADD LVL C 3099 NW-MB-IU-4999-U-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZ1TD - BRONZE FOR PRO 1YR LATE ADD LVL D100499 NW-JS-IU-149-FP - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZ1TE - BRONZE FOR PRO 1YR LATE ADD LVL E 500+ NW-JS-IU-4999-U - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZREN1TC - BRONZE FOR PRO 1YR LATE RENEW LVL C 3099 NW-HC-IU-4999-U - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZREN1TD - BRONZE FOR PRO 1YR LATE RENEW LVLD100499 NW-MB-IU-999-U-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZREN1TE - BRONZE FOR PRO1YR LATE RENEW LVL E 500+ NW-MS-IU-9999-U-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZREN1TB - BRONZE FOR PRO1YR LATE RENEWLVLB1029 NW-JS-IU-9999-U - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZREN1B - BRONZE FOR PRO1YR ONTIME RENEW LVLB1029 NW-MS-IU-999-U-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZREN1C - BRONZE FOR PRO1YR ONTIMERENEW LVLC3099 NW-MS-IU-9999-U-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZREN1E - BRONZE FOR PRO1YR ONTIMERENEW LVLE500+ NW-MB-IU-9999-U-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
ACTPROBRZREN1D - BRONZE FOR PRO1YRONTIME RENEWLVL D100499 NW-MS-IU-149-FP-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
FT-WLESS - BUSINESS GRADE WIRELESS - 1 DAY NW-MS-IU-4999-U-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
WSBUSHDRM - BUSINESS HOURS HELP DESK PER SEAT NW-MB-IU-999-U-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
13583626 - BUSN CRI SER CONTROL COMPLIANCE FAMILY NW-MS-IU-29999-U-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
7008441-7017598-ENT - BY MITI ADD-ON FYM ENT SUPRT NW-JS-IU-29999-U - NETWRIX AUDITOR FOR INACTIVE USERS
7010282-7017598-STD - BY MITI ADD-ON FYM STD SUPRT NW-MB-IU-149-FP-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
GMRBABLB10S18CG - CA ARCSERVE BACKUP R11.5 AGENT FOR FREEBSD - MAINTENANCE SKU NW-MS-IU-4999-U-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
GMRBABLB10S18GG - CA ARCSERVE BACKUP R11.5 AGENT FOR FREEBSD - MAINTENANCE SKU NW-HC-IU-149-FP - NETWRIX AUDITOR FOR INACTIVE USERS
GMRBABLB10S18GJ - CA ARCSERVE BACKUP R11.5 AGENT FOR FREEBSD - MAINTENANCE SKU NW-MB-IU-149-FP-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
GMRBABLB10S18CJ - CA ARCSERVE BACKUP R11.5 AGENT FOR FREEBSD - MAINTENANCE SKU NW-MS-IU-29999-U-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
7015471-7017641-ENT - CAC AUTHENTICATION OPTION FYM ENT SUPRT NW-JS-IU-999-U - NETWRIX AUDITOR FOR INACTIVE USERS
7015470-7017641-STD - CAC AUTHENTICATION OPTION FYM STD SUPRT NW-P-IU-999-U-PS - NETWRIX AUDITOR FOR INACTIVE USERS
FG3002-20 - CAFE DUET NDT-CAFEDUET PROGRAMMING NW-P-IU-29999-U-PS - NETWRIX AUDITOR FOR INACTIVE USERS
CAMSAV49U-8-E - CAMTASIA STUDIO UPGRADE TIER 25-49 (MAINT. REQUIRED FOR THIS PRICING) NW-MB-IU-4999-U-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
AP911000 - CAPACITY 1000 RACK LICENSE NW-MB-IU-29999-U-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
WCAM1M10 - CAPACITY MGR 1 MONTH SUPPORT 10 RACKS NW-MB-IU-999-U-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
WCAM1M100 - CAPACITY MGR 1 MONTH SUPPORT 100 RACKS NW-MB-IU-9999-U-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
WCAM1M200 - CAPACITY MGR 1 MONTH SUPPORT200 RACKS NW-MS-IU-149-FP-3YR - NETWRIX AUDITOR FOR INACTIVE USERS
WCAM1YR10 - CAPACITY MGR 1 YEAR CONTRACT 10 RACKS NW-HC-IU-9999-U - NETWRIX AUDITOR FOR INACTIVE USERS
WCAM1YR200 - CAPACITY MGR 1 YEAR CONTRACT 200 RACKS NW-MS-IU-4999-U-1YR - NETWRIX AUDITOR FOR INACTIVE USERS
WCAM1YR100 - CAPACITY MGR 1 YEARCONTRACT 100 RACKS NW-MS-IU-999-U-2YR - NETWRIX AUDITOR FOR INACTIVE USERS
WCAM3YR10 - CAPACITY MGR 3 YEAR CONTRACT 10 RACKS NW-MS-PE-149-FP-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCAM3YR100 - CAPACITY MGR 3 YEAR CONTRACT 100 RACKS NW-MB-PE-9999-U-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCAM3YR200 - CAPACITY MGR 3 YEAR CONTRACT 200 RACKS NW-MS-PE-149-FP-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
UA103E - CARE PACK 1YR 9X5 UNLIMITED LINUX IA32 SW Tech Sup NW-MS-PE-9999-U-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
90001-R01-HDH - CATCH UP FEE FOR HD HEALTH NW-MS-PE-29999-U-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
90001-C01-HDH - CATCH UP FEE FOR HD HEALTH NW-JS-PE-4999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
CPTS-EXAM-CCMA - CCMA LAB EXAM FEE DELIVERED AT CHECK POI NW-P-PE-4999-U-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WMS3YR500N - CENTRAL SOFTWARE SUPPORT CONTRACT NW-MS-PE-4999-U-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
NAU-1510 - CETERM ANNUAL MAINTENANCE CONTRACT (FREE VERSIONS UPGRADES - PURCHASED PER LICEN NW-MB-PE-149-FP-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
7016181-FOR-ENT - CHANGE DATA CAPTURE EDITION FOR ENT SUPP NW-MB-PE-999-U-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
7015471-7016181-ENT - CHANGE DATA CAPTURE EDITION FYM ENT SUPP NW-MB-PE-9999-U-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM1M25 - CHANGE MGR 1 MONTH SUPPORT 25 DEVICES NW-JS-PE-149-FP - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM1M100 - CHANGE MGR 1 MONTH SUPPORT 100 DEVICES NW-JS-PE-999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM1M1000 - CHANGE MGR 1 MONTH SUPPORT 1000 DEVICES NW-MB-PE-149-FP-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM1M500 - CHANGE MGR 1 MONTHSUPPORT 500 DEVICES NW-MB-PE-4999-U-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM1YR100 - CHANGE MGR 1 YEAR CONTRACT 100 DEVICES NW-MS-PE-9999-U-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM1YR500 - CHANGE MGR 1 YEAR CONTRACT 500 DEVICES NW-MS-PE-29999-U-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM1YR1000 - CHANGE MGR 1 YEAR CONTRACT 1000 DEVICES NW-MB-PE-4999-U-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM3YR100 - CHANGE MGR 3 YEAR CONTRACT 100 DEVICES NW-MS-PE-999-U-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM3YR25 - CHANGE MGR 3 YEAR CONTRACT 25 DEVICES NW-MS-PE-9999-U-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM3YR500 - CHANGE MGR 3 YEAR CONTRACT 500 DEVICES NW-HC-PE-29999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
WCHM3YR1000 - CHANGE MGR 3 YEAR CONTRACT1000 DEVICES NW-P-PE-29999-U-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
P-NP-SPXXL00 - CHROME/3YEAR/DEPOT MAIL IN NW-MS-PE-29999-U-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
P-NP-2HXXL00 - CHROME/3YEAR/DEPOT MAIL IN/ADH NW-MB-PE-4999-U-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
P-NP-XPXXL00 - CHROME/4YEAR/DEPOT MAIL IN NW-MB-PE-29999-U-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
P-NP-3HXXL00 - CHROME/4YEAR/DEPOT MAIL IN/ADH NW-JS-PE-29999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
P-NP-4PXXL00 - CHROME/5YEAR/DEPOT MAIL IN NW-HC-PE-999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
P-NP-4HXXL00 - CHROME/5YEAR/DEPOT MAIL IN/ADH NW-MB-PE-999-U-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
CTC-GD-COF-3 - CITY OF PHOENIX COMPUTRACE 3YR NW-MS-PE-4999-U-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
CPSB-EP-WEBC - CKP ENDPOINT WEBCHECK BLADE FOR 1 YR NW-MB-PE-999-U-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
RB-TRCL - CLIENT LCTN- 3 ATTND TRAVEL EXP PER DAY NW-JS-PE-9999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-A-12 - CLOUD BAND A 12 MONTH NW-MS-PE-999-U-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-A-12 - CLOUD BAND A 12 MONTH NW-MB-PE-29999-U-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-A-24-Y2 - CLOUD BAND A 24 MONTH NW-MS-PE-999-U-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-A-24-Y2 - CLOUD BAND A 24 MONTH NW-MS-PE-4999-U-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-A-24-Y1 - CLOUD BAND A 24 MONTH NW-P-PE-9999-U-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-A-24-Y1 - CLOUD BAND A 24 MONTH NW-MB-PE-9999-U-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-A-36-Y1 - CLOUD BAND A 36 MONTH NW-MS-PE-149-FP-2YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-A-36-Y3 - CLOUD BAND A 36 MONTH NW-HC-PE-9999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-A-36-Y1 - CLOUD BAND A 36 MONTH NW-P-PE-999-U-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-A-36-Y2 - CLOUD BAND A 36 MONTH NW-MB-PE-999-U-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-A-36-Y3 - CLOUD BAND A 36 MONTH NW-MS-PE-999-U-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-A-36-Y2 - CLOUD BAND A 36 MONTH NW-P-PE-999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-B-12 - CLOUD BAND B 12 MONTH NW-MS-PE-149-FP-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-B-12 - CLOUD BAND B 12 MONTH NW-MS-PE-999-U-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-B-24-Y2 - CLOUD BAND B 24 MONTH NW-MB-PE-9999-U-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-B-24-Y1 - CLOUD BAND B 24 MONTH NW-MS-PE-149-FP-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-B-24-Y2 - CLOUD BAND B 24 MONTH NW-MB-PE-29999-U-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-B-24-Y1 - CLOUD BAND B 24 MONTH NW-MB-PE-149-FP-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-B-36-Y2 - CLOUD BAND B 36 MONTH NW-MB-PE-29999-U-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-B-36-Y1 - CLOUD BAND B 36 MONTH NW-MS-PE-4999-U-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-B-36-Y3 - CLOUD BAND B 36 MONTH NW-MS-PE-9999-U-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-B-36-Y2 - CLOUD BAND B 36 MONTH NW-MS-PE-4999-U-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-B-36-Y1 - CLOUD BAND B 36 MONTH NW-MB-PE-4999-U-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-B-36-Y3 - CLOUD BAND B 36 MONTH NW-JS-PE-149-FP-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-C-12 - CLOUD BAND C 12 MONTH NW-JS-PE-4999-U-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-C-12 - CLOUD BAND C 12 MONTH NW-MB-PE-9999-U-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-C-24-Y1 - CLOUD BAND C 24 MONTH NW-MS-PE-149-FP-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-C-24-Y2 - CLOUD BAND C 24 MONTH NW-MS-PE-29999-U-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-C-24-Y1 - CLOUD BAND C 24 MONTH NW-JS-PE-999-U-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-C-24-Y2 - CLOUD BAND C 24 MONTH NW-MB-PE-149-FP-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-C-36-Y3 - CLOUD BAND C 36 MONTH NW-MB-PE-4999-U-1YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-C-36-Y2 - CLOUD BAND C 36 MONTH NW-MB-PE-9999-U-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-C-36-Y2 - CLOUD BAND C 36 MONTH NW-MS-PE-9999-U-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-C-36-Y3 - CLOUD BAND C 36 MONTH NW-MB-PE-149-FP-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-C-36-Y1 - CLOUD BAND C 36 MONTH NW-P-PE-29999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-C-36-Y1 - CLOUD BAND C 36 MONTH NW-MB-PE-999-U-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-D-12 - CLOUD BAND D 12 MONTH NW-MS-PE-999-U-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-D-12 - CLOUD BAND D 12 MONTH NW-MS-PE-29999-U-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-D-24-Y1 - CLOUD BAND D 24 MONTH NW-MB-PE-4999-U-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-D-24-Y1 - CLOUD BAND D 24 MONTH NW-MB-PE-29999-U-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-D-24-Y2 - CLOUD BAND D 24 MONTH NW-MS-PE-29999-U-2YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-D-24-Y2 - CLOUD BAND D 24 MONTH NW-MB-PE-999-U-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-D-36-Y2 - CLOUD BAND D 36 MONTH NW-JS-PE-29999-U-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-D-36-Y3 - CLOUD BAND D 36 MONTH NW-JS-PE-9999-U-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-D-36-Y3 - CLOUD BAND D 36 MONTH NW-P-PE-149-FP - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-D-36-Y1 - CLOUD BAND D 36 MONTH NW-P-PE-4999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-D-36-Y2 - CLOUD BAND D 36 MONTH NW-P-PE-9999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-D-36-Y1 - CLOUD BAND D 36 MONTH NW-MS-PE-4999-U-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-E-12 - CLOUD BAND E 12 MONTH NW-MS-PE-9999-U-3YR-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-E-12 - CLOUD BAND E 12 MONTH NW-MB-PE-29999-U-1YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-E-24-Y1 - CLOUD BAND E 24 MONTH NW-MB-PE-149-FP-3YR - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-E-24-Y2 - CLOUD BAND E 24 MONTH NW-HC-PE-149-FP - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210906-28A-E-24-Y1 - CLOUD BAND E 24 MONTH NW-HC-PE-4999-U - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-E-24-Y2 - CLOUD BAND E 24 MONTH NW-P-PE-149-FP-PS - NETWRIX AUDITOR FOR PASSWORD EXPIRATION
21210992-28A-E-36-Y3 - CLOUD BAND E 36 MONTH NW-MB-SP-29999-U-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-E-36-Y3 - CLOUD BAND E 36 MONTH NW-JS-SP-29999-U-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-E-36-Y2 - CLOUD BAND E 36 MONTH NW-MB-SP-9999-U-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-E-36-Y1 - CLOUD BAND E 36 MONTH NW-MS-SP-149-FP-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-E-36-Y1 - CLOUD BAND E 36 MONTH NW-MS-SP-4999-U-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-E-36-Y2 - CLOUD BAND E 36 MONTH NW-MB-SP-149-FP-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-F-12 - CLOUD BAND F 12 MONTH NW-MS-SP-4999-U-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-F-12 - CLOUD BAND F 12 MONTH NW-MS-SP-29999-U-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-F-24-Y2 - CLOUD BAND F 24 MONTH NW-MS-SP-4999-U-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-F-24-Y1 - CLOUD BAND F 24 MONTH NW-MS-SP-29999-U-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-F-24-Y1 - CLOUD BAND F 24 MONTH NW-MB-SP-149-FP-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-F-24-Y2 - CLOUD BAND F 24 MONTH NW-JS-SP-999-U-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-F-36-Y2 - CLOUD BAND F 36 MONTH NW-JS-SP-9999-U-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-F-36-Y3 - CLOUD BAND F 36 MONTH NW-MB-SP-149-FP-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-F-36-Y2 - CLOUD BAND F 36 MONTH NW-MS-SP-149-FP-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-F-36-Y1 - CLOUD BAND F 36 MONTH NW-MB-SP-4999-U-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-F-36-Y3 - CLOUD BAND F 36 MONTH NW-MS-SP-149-FP-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-F-36-Y1 - CLOUD BAND F 36 MONTH NW-P-SP-29999-U-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-G-12 - CLOUD BAND G 12 MONTH NW-MB-SP-29999-U-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-G-12 - CLOUD BAND G 12 MONTH NW-MS-SP-29999-U-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-G-24-Y1 - CLOUD BAND G 24 MONTH NW-MS-SP-999-U-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-G-24-Y1 - CLOUD BAND G 24 MONTH NW-MS-SP-999-U-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-G-24-Y2 - CLOUD BAND G 24 MONTH NW-MS-SP-9999-U-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-G-24-Y2 - CLOUD BAND G 24 MONTH NW-MB-SP-29999-U-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-G-36-Y3 - CLOUD BAND G 36 MONTH NW-MB-SP-999-U-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-G-36-Y3 - CLOUD BAND G 36 MONTH NW-JS-SP-4999-U-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-G-36-Y2 - CLOUD BAND G 36 MONTH NW-P-SP-4999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-G-36-Y1 - CLOUD BAND G 36 MONTH NW-P-SP-999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210906-28A-G-36-Y2 - CLOUD BAND G 36 MONTH NW-P-SP-29999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210992-28A-G-36-Y1 - CLOUD BAND G 36 MONTH NW-MB-SP-999-U-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-A-24-Y1 - CLOUD BLACKBERRY OPTION BAND A 24MO YR1 NW-MS-SP-29999-U-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-A-24-Y2 - CLOUD BLACKBERRY OPTION BAND A 24MO YR2 NW-MB-SP-4999-U-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-A-36-Y1 - CLOUD BLACKBERRY OPTION BAND A 36MO YR1 NW-MB-SP-4999-U-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-A-36-Y2 - CLOUD BLACKBERRY OPTION BAND A 36MO YR2 NW-MB-SP-9999-U-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-A-36-Y3 - CLOUD BLACKBERRY OPTION BAND A 36MO YR3 NW-MS-SP-149-FP-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-B-24-Y1 - CLOUD BLACKBERRY OPTION BAND B 24MO YR1 NW-JS-SP-4999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-B-24-Y2 - CLOUD BLACKBERRY OPTION BAND B 24MO YR2 NW-JS-SP-29999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-B-36-Y1 - CLOUD BLACKBERRY OPTION BAND B 36MO YR1 NW-HC-SP-999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-B-36-Y2 - CLOUD BLACKBERRY OPTION BAND B 36MO YR2 NW-MB-SP-4999-U-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-B-36-Y3 - CLOUD BLACKBERRY OPTION BAND B 36MO YR3 NW-MB-SP-29999-U-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-C-24-Y1 - CLOUD BLACKBERRY OPTION BAND C 24MO YR1 NW-MS-SP-999-U-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-C-24-Y2 - CLOUD BLACKBERRY OPTION BAND C 24MO YR2 NW-MS-SP-9999-U-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-C-36-Y1 - CLOUD BLACKBERRY OPTION BAND C 36MO YR1 NW-MB-SP-9999-U-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-C-36-Y2 - CLOUD BLACKBERRY OPTION BAND C 36MO YR2 NW-P-SP-149-FP - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-C-36-Y3 - CLOUD BLACKBERRY OPTION BAND C 36MO YR3 NW-MB-SP-9999-U-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-D-24-Y1 - CLOUD BLACKBERRY OPTION BAND D 24MO YR1 NW-MS-SP-4999-U-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-D-24-Y2 - CLOUD BLACKBERRY OPTION BAND D 24MO YR2 NW-MB-SP-29999-U-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-D-36-Y1 - CLOUD BLACKBERRY OPTION BAND D 36MO YR1 NW-MB-SP-149-FP-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-D-36-Y2 - CLOUD BLACKBERRY OPTION BAND D 36MO YR2 NW-MB-SP-999-U-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-D-36-Y3 - CLOUD BLACKBERRY OPTION BAND D 36MO YR3 NW-MS-SP-9999-U-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-E-24-Y1 - CLOUD BLACKBERRY OPTION BAND E 24MO YR1 NW-MS-SP-149-FP-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-E-24-Y2 - CLOUD BLACKBERRY OPTION BAND E 24MO YR2 NW-JS-SP-149-FP - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-E-36-Y1 - CLOUD BLACKBERRY OPTION BAND E 36MO YR1 NW-HC-SP-9999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-E-36-Y2 - CLOUD BLACKBERRY OPTION BAND E 36MO YR2 NW-MB-SP-149-FP-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-E-36-Y3 - CLOUD BLACKBERRY OPTION BAND E 36MO YR3 NW-MB-SP-999-U-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-F-24-Y1 - CLOUD BLACKBERRY OPTION BAND F 24MO YR1 NW-MS-SP-4999-U-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-F-24-Y2 - CLOUD BLACKBERRY OPTION BAND F 24MO YR2 NW-MB-SP-29999-U-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-F-36-Y1 - CLOUD BLACKBERRY OPTION BAND F 36MO YR1 NW-MS-SP-999-U-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-F-36-Y2 - CLOUD BLACKBERRY OPTION BAND F 36MO YR2 NW-MS-SP-999-U-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-F-36-Y3 - CLOUD BLACKBERRY OPTION BAND F 36MO YR3 NW-MS-SP-29999-U-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-G-24-Y1 - CLOUD BLACKBERRY OPTION BAND G 24MO YR1 NW-MS-SP-4999-U-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-G-24-Y2 - CLOUD BLACKBERRY OPTION BAND G 24MO YR2 NW-MS-SP-29999-U-3YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-G-36-Y1 - CLOUD BLACKBERRY OPTION BAND G 36MO YR1 NW-MB-SP-149-FP-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-G-36-Y2 - CLOUD BLACKBERRY OPTION BAND G 36MO YR2 NW-HC-SP-4999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21210991-26A-G-36-Y3 - CLOUD BLACKBERRY OPTION BAND G 36MO YR3 NW-HC-SP-29999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-A-24-Y1 - CLOUD FILE ARCHIVE BAND A 24MO YR1 NW-MS-SP-149-FP-1YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-A-24-Y2 - CLOUD FILE ARCHIVE BAND A 24MO YR2 NW-MS-SP-9999-U-2YR - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-A-36-Y1 - CLOUD FILE ARCHIVE BAND A 36MO YR1 NW-P-SP-9999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-A-36-Y2 - CLOUD FILE ARCHIVE BAND A 36MO YR2 NW-MB-SP-999-U-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-A-36-Y3 - CLOUD FILE ARCHIVE BAND A 36MO YR3 NW-MB-SP-4999-U-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-B-24-Y1 - CLOUD FILE ARCHIVE BAND B 24MO YR1 NW-MB-SP-9999-U-3YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-B-24-Y2 - CLOUD FILE ARCHIVE BAND B 24MO YR2 NW-JS-SP-149-FP-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-B-36-Y1 - CLOUD FILE ARCHIVE BAND B 36MO YR1 NW-P-SP-4999-U-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-B-36-Y2 - CLOUD FILE ARCHIVE BAND B 36MO YR2 NW-P-SP-9999-U-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-B-36-Y3 - CLOUD FILE ARCHIVE BAND B 36MO YR3 NW-P-SP-149-FP-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-C-24-Y1 - CLOUD FILE ARCHIVE BAND C 24MO YR1 NW-P-SP-999-U-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-C-24-Y2 - CLOUD FILE ARCHIVE BAND C 24MO YR2 NW-JS-SP-999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-C-36-Y1 - CLOUD FILE ARCHIVE BAND C 36MO YR1 NW-JS-SP-9999-U - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-C-36-Y2 - CLOUD FILE ARCHIVE BAND C 36MO YR2 NW-HC-SP-149-FP - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-C-36-Y3 - CLOUD FILE ARCHIVE BAND C 36MO YR3 NW-MB-SP-4999-U-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-D-24-Y1 - CLOUD FILE ARCHIVE BAND D 24MO YR1 NW-MS-SP-999-U-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-D-24-Y2 - CLOUD FILE ARCHIVE BAND D 24MO YR2 NW-MS-SP-9999-U-1YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-D-36-Y1 - CLOUD FILE ARCHIVE BAND D 36MO YR1 NW-MB-SP-999-U-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-D-36-Y2 - CLOUD FILE ARCHIVE BAND D 36MO YR2 NW-MB-SP-9999-U-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-D-36-Y3 - CLOUD FILE ARCHIVE BAND D 36MO YR3 NW-MS-SP-9999-U-2YR-PS - NETWRIX AUDITOR FOR SHAREPOINT SERVER
21271948-26A-E-24-Y1 - CLOUD FILE ARCHIVE BAND E 24MO YR1 NW-MB-SQL-999-U-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-E-24-Y2 - CLOUD FILE ARCHIVE BAND E 24MO YR2 NW-MB-SQL-9999-U-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-E-36-Y1 - CLOUD FILE ARCHIVE BAND E 36MO YR1 NW-MS-SQL-9999-U-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-E-36-Y2 - CLOUD FILE ARCHIVE BAND E 36MO YR2 NW-JS-SQL-149-FP-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-E-36-Y3 - CLOUD FILE ARCHIVE BAND E 36MO YR3 NW-MB-SQL-4999-U-2YR - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-F-24-Y1 - CLOUD FILE ARCHIVE BAND F 24MO YR1 NW-MB-SQL-29999-U-2YR - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-F-24-Y2 - CLOUD FILE ARCHIVE BAND F 24MO YR2 NW-MS-SQL-999-U-2YR - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-F-36-Y1 - CLOUD FILE ARCHIVE BAND F 36MO YR1 NW-MS-SQL-999-U-3YR - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-F-36-Y2 - CLOUD FILE ARCHIVE BAND F 36MO YR2 NW-MS-SQL-29999-U-3YR - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-F-36-Y3 - CLOUD FILE ARCHIVE BAND F 36MO YR3 NW-P-SQL-9999-U-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-G-24-Y1 - CLOUD FILE ARCHIVE BAND G 24MO YR1 NW-P-SQL-29999-U-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-G-24-Y2 - CLOUD FILE ARCHIVE BAND G 24MO YR2 NW-MB-SQL-4999-U-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-G-36-Y1 - CLOUD FILE ARCHIVE BAND G 36MO YR1 NW-MB-SQL-29999-U-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-G-36-Y2 - CLOUD FILE ARCHIVE BAND G 36MO YR2 NW-P-SQL-149-FP-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-G-36-Y3 - CLOUD FILE ARCHIVE BAND G 36MO YR3 NW-P-SQL-4999-U-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-A-12 - CLOUD FILE ARCHIVE OPTION BAND A 12MO NW-MB-SQL-9999-U-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-B-12 - CLOUD FILE ARCHIVE OPTION BAND B 12MO NW-MB-SQL-149-FP-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-C-12 - CLOUD FILE ARCHIVE OPTION BAND C 12MO NW-MB-SQL-9999-U-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-D-12 - CLOUD FILE ARCHIVE OPTION BAND D 12MO NW-MS-SQL-9999-U-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-E-12 - CLOUD FILE ARCHIVE OPTION BAND E 12MO NW-MB-SQL-4999-U-1YR - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-F-12 - CLOUD FILE ARCHIVE OPTION BAND F 12MO NW-P-SQL-149-FP - NETWRIX AUDITOR FOR SQL SERVER
21271948-26A-G-12 - CLOUD FILE ARCHIVE OPTION BAND G 12MO NW-P-SQL-9999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-A-12 - CLOUD FOLDER SYNC OPTION BAND A 12MO NW-P-SQL-999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-A-24-Y1 - CLOUD FOLDER SYNC OPTION BAND A 24MO YR1 NW-P-SQL-4999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-A-24-Y2 - CLOUD FOLDER SYNC OPTION BAND A 24MO YR2 NW-P-SQL-29999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-A-36-Y1 - CLOUD FOLDER SYNC OPTION BAND A 36MO YR1 NW-MS-SQL-9999-U-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-A-36-Y2 - CLOUD FOLDER SYNC OPTION BAND A 36MO YR2 NW-JS-SQL-9999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-A-36-Y3 - CLOUD FOLDER SYNC OPTION BAND A 36MO YR3 NW-HC-SQL-999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-B-12 - CLOUD FOLDER SYNC OPTION BAND B 12MO NW-MB-SQL-9999-U-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-B-24-Y1 - CLOUD FOLDER SYNC OPTION BAND B 24MO YR1 NW-MS-SQL-4999-U-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-B-24-Y2 - CLOUD FOLDER SYNC OPTION BAND B 24MO YR2 NW-MS-SQL-29999-U-2YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-B-36-Y1 - CLOUD FOLDER SYNC OPTION BAND B 36MO YR1 NW-MB-SQL-29999-U-3YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-B-36-Y2 - CLOUD FOLDER SYNC OPTION BAND B 36MO YR2 NW-JS-SQL-4999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-B-36-Y3 - CLOUD FOLDER SYNC OPTION BAND B 36MO YR3 NW-HC-SQL-29999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-C-12 - CLOUD FOLDER SYNC OPTION BAND C 12MO NW-HC-SQL-149-FP - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-C-24-Y1 - CLOUD FOLDER SYNC OPTION BAND C 24MO YR1 NW-HC-SQL-4999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-C-24-Y2 - CLOUD FOLDER SYNC OPTION BAND C 24MO YR2 NW-MB-SQL-149-FP-2YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-C-36-Y1 - CLOUD FOLDER SYNC OPTION BAND C 36MO YR1 NW-MB-SQL-149-FP-3YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-C-36-Y2 - CLOUD FOLDER SYNC OPTION BAND C 36MO YR2 NW-MB-SQL-9999-U-3YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-C-36-Y3 - CLOUD FOLDER SYNC OPTION BAND C 36MO YR3 NW-JS-SQL-999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-D-12 - CLOUD FOLDER SYNC OPTION BAND D 12MO NW-MS-SQL-29999-U-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-D-24-Y1 - CLOUD FOLDER SYNC OPTION BAND D 24MO YR1 NW-MB-SQL-999-U-2YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-D-24-Y2 - CLOUD FOLDER SYNC OPTION BAND D 24MO YR2 NW-MS-SQL-149-FP-2YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-D-36-Y1 - CLOUD FOLDER SYNC OPTION BAND D 36MO YR1 NW-MS-SQL-149-FP-3YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-D-36-Y2 - CLOUD FOLDER SYNC OPTION BAND D 36MO YR2 NW-MS-SQL-9999-U-3YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-D-36-Y3 - CLOUD FOLDER SYNC OPTION BAND D 36MO YR3 NW-JS-SQL-149-FP - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-E-12 - CLOUD FOLDER SYNC OPTION BAND E 12MO NW-MB-SQL-9999-U-2YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-E-24-Y1 - CLOUD FOLDER SYNC OPTION BAND E 24MO YR1 NW-MS-SQL-4999-U-2YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-E-24-Y2 - CLOUD FOLDER SYNC OPTION BAND E 24MO YR2 NW-MS-SQL-4999-U-3YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-E-36-Y1 - CLOUD FOLDER SYNC OPTION BAND E 36MO YR1 NW-MB-SQL-999-U-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-E-36-Y2 - CLOUD FOLDER SYNC OPTION BAND E 36MO YR2 NW-MB-SQL-29999-U-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-E-36-Y3 - CLOUD FOLDER SYNC OPTION BAND E 36MO YR3 NW-MS-SQL-149-FP-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-F-12 - CLOUD FOLDER SYNC OPTION BAND F 12MO NW-MS-SQL-999-U-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-F-24-Y1 - CLOUD FOLDER SYNC OPTION BAND F 24MO YR1 NW-MS-SQL-9999-U-2YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-F-24-Y2 - CLOUD FOLDER SYNC OPTION BAND F 24MO YR2 NW-MB-SQL-999-U-3YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-F-36-Y1 - CLOUD FOLDER SYNC OPTION BAND F 36MO YR1 NW-JS-SQL-29999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-F-36-Y2 - CLOUD FOLDER SYNC OPTION BAND F 36MO YR2 NW-HC-SQL-9999-U - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-F-36-Y3 - CLOUD FOLDER SYNC OPTION BAND F 36MO YR3 NW-MB-SQL-4999-U-3YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-G-12 - CLOUD FOLDER SYNC OPTION BAND G 12MO NW-MB-SQL-149-FP-1YR - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-G-24-Y1 - CLOUD FOLDER SYNC OPTION BAND G 24MO YR1 NW-MB-SQL-149-FP-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-G-24-Y2 - CLOUD FOLDER SYNC OPTION BAND G 24MO YR2 NW-MS-SQL-149-FP-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-G-36-Y1 - CLOUD FOLDER SYNC OPTION BAND G 36MO YR1 NW-MS-SQL-149-FP-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-G-36-Y2 - CLOUD FOLDER SYNC OPTION BAND G 36MO YR2 NW-MB-SQL-149-FP-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21210971-26A-G-36-Y3 - CLOUD FOLDER SYNC OPTION BAND G 36MO YR3 NW-MB-SQL-4999-U-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
UC6-CRM-25P-STD - CLOUD RESOURCE METER PRO - ANNUAL LICENSE - 25 MACHINE INSTANCE PACK NW-MS-SQL-29999-U-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
020-251-092 - CLOUD SERVICES IMPLEMENTATION - EVAULT - 101TO 200 GB, ONE-TIME NW-JS-SQL-29999-U-PS - NETWRIX AUDITOR FOR SQL SERVER
020-251-093 - CLOUD SERVICES IMPLEMENTATION - EVAULT - 201 TO 400 GB, ONE-TIME NW-MB-SQL-999-U-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
020-251-094 - CLOUD SERVICES IMPLEMENTATION - EVAULT 401 TO 700 GB, ONE-TIME NW-MS-SQL-999-U-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
020-251-095 - CLOUD SERVICES IMPLEMENTATION-EVAULT-1TB AND OVER, ONE-TIME NW-MS-SQL-29999-U-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-A-24-Y1 - CLOUD SFDC CHATTER BAND A 24MO YR1 NW-MS-SQL-149-FP-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-A-24-Y2 - CLOUD SFDC CHATTER BAND A 24MO YR2 NW-MS-SQL-4999-U-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-A-36-Y1 - CLOUD SFDC CHATTER BAND A 36MO YR1 NW-MS-SQL-29999-U-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-A-36-Y2 - CLOUD SFDC CHATTER BAND A 36MO YR2 NW-MB-SQL-999-U-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-A-36-Y3 - CLOUD SFDC CHATTER BAND A 36MO YR3 NW-MB-SQL-4999-U-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-B-24-Y1 - CLOUD SFDC CHATTER BAND B 24MO YR1 NW-MS-SQL-999-U-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-B-24-Y2 - CLOUD SFDC CHATTER BAND B 24MO YR2 NW-MS-SQL-9999-U-1YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-B-36-Y1 - CLOUD SFDC CHATTER BAND B 36MO YR1 NW-P-SQL-999-U-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-B-36-Y2 - CLOUD SFDC CHATTER BAND B 36MO YR2 NW-MB-SQL-29999-U-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-B-36-Y3 - CLOUD SFDC CHATTER BAND B 36MO YR3 NW-MS-SQL-4999-U-2YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-C-24-Y1 - CLOUD SFDC CHATTER BAND C 24MO YR1 NW-MB-SQL-29999-U-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-C-24-Y2 - CLOUD SFDC CHATTER BAND C 24MO YR2 NW-MS-SQL-4999-U-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-C-36-Y1 - CLOUD SFDC CHATTER BAND C 36MO YR1 NW-JS-SQL-4999-U-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-C-36-Y2 - CLOUD SFDC CHATTER BAND C 36MO YR2 NW-JS-SQL-9999-U-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-C-36-Y3 - CLOUD SFDC CHATTER BAND C 36MO YR3 NW-MS-SQL-999-U-3YR-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-D-24-Y1 - CLOUD SFDC CHATTER BAND D 24MO YR1 NW-JS-SQL-999-U-PS - NETWRIX AUDITOR FOR SQL SERVER
21274840-26A-D-24-Y2 - CLOUD SFDC CHATTER BAND D 24MO YR2 NW-P-VM-999-U-PS - NETWRIX AUDITOR FOR VMWARE
21274840-26A-D-36-Y1 - CLOUD SFDC CHATTER BAND D 36MO YR1 NW-P-VM-149-FP - NETWRIX AUDITOR FOR VMWARE
21274840-26A-D-36-Y2 - CLOUD SFDC CHATTER BAND D 36MO YR2 NW-MB-VM-4999-U-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-D-36-Y3 - CLOUD SFDC CHATTER BAND D 36MO YR3 NW-MB-VM-9999-U-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-E-24-Y1 - CLOUD SFDC CHATTER BAND E 24MO YR1 NW-MB-VM-9999-U-2YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-E-24-Y2 - CLOUD SFDC CHATTER BAND E 24MO YR2 NW-MS-VM-29999-U-2YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-E-36-Y1 - CLOUD SFDC CHATTER BAND E 36MO YR1 NW-MB-VM-999-U-3YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-E-36-Y2 - CLOUD SFDC CHATTER BAND E 36MO YR2 NW-JS-VM-29999-U - NETWRIX AUDITOR FOR VMWARE
21274840-26A-E-36-Y3 - CLOUD SFDC CHATTER BAND E 36MO YR3 NW-HC-VM-999-U - NETWRIX AUDITOR FOR VMWARE
21274840-26A-F-24-Y1 - CLOUD SFDC CHATTER BAND F 24MO YR1 NW-HC-VM-9999-U - NETWRIX AUDITOR FOR VMWARE
21274840-26A-F-24-Y2 - CLOUD SFDC CHATTER BAND F 24MO YR2 NW-MB-VM-149-FP-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-F-36-Y1 - CLOUD SFDC CHATTER BAND F 36MO YR1 NW-MS-VM-9999-U-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-F-36-Y2 - CLOUD SFDC CHATTER BAND F 36MO YR2 NW-MS-VM-149-FP-2YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-F-36-Y3 - CLOUD SFDC CHATTER BAND F 36MO YR3 NW-MB-VM-4999-U-3YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-G-24-Y1 - CLOUD SFDC CHATTER BAND G 24MO YR1 NW-MS-VM-4999-U-3YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-G-24-Y2 - CLOUD SFDC CHATTER BAND G 24MO YR2 NW-JS-VM-4999-U - NETWRIX AUDITOR FOR VMWARE
21274840-26A-G-36-Y1 - CLOUD SFDC CHATTER BAND G 36MO YR1 NW-HC-VM-149-FP - NETWRIX AUDITOR FOR VMWARE
21274840-26A-G-36-Y2 - CLOUD SFDC CHATTER BAND G 36MO YR2 NW-P-VM-4999-U - NETWRIX AUDITOR FOR VMWARE
21274840-26A-G-36-Y3 - CLOUD SFDC CHATTER BAND G 36MO YR3 NW-MS-VM-999-U-2YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-A-12 - CLOUD SFDC CHATTER OPTION BAND A 12MO NW-JS-VM-9999-U - NETWRIX AUDITOR FOR VMWARE
21274840-26A-B-12 - CLOUD SFDC CHATTER OPTION BAND B 12MO NW-MB-VM-999-U-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-C-12 - CLOUD SFDC CHATTER OPTION BAND C 12MO NW-MB-VM-29999-U-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-D-12 - CLOUD SFDC CHATTER OPTION BAND D 12MO NW-MS-VM-999-U-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-E-12 - CLOUD SFDC CHATTER OPTION BAND E 12MO NW-MS-VM-9999-U-3YR - NETWRIX AUDITOR FOR VMWARE
21274840-26A-F-12 - CLOUD SFDC CHATTER OPTION BAND F 12MO NW-JS-VM-999-U - NETWRIX AUDITOR FOR VMWARE
21274840-26A-G-12 - CLOUD SFDC CHATTER OPTION BAND G 12MO NW-MS-VM-149-FP-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-27A-A-12 - CLOUD SFDC CHATTER OPTIONA 12 MONTH NW-MB-VM-149-FP-2YR - NETWRIX AUDITOR FOR VMWARE
21274840-27A-B-12 - CLOUD SFDC CHATTER OPTIONB 12 MONTH NW-MS-VM-4999-U-2YR - NETWRIX AUDITOR FOR VMWARE
21274840-27A-C-12 - CLOUD SFDC CHATTER OPTIONC 12 MONTH NW-MB-VM-29999-U-3YR - NETWRIX AUDITOR FOR VMWARE
21274840-27A-D-12 - CLOUD SFDC CHATTER OPTIOND 12 MONTH NW-MS-VM-149-FP-3YR - NETWRIX AUDITOR FOR VMWARE
21274840-27A-E-12 - CLOUD SFDC CHATTER OPTIONE 12 MONTH NW-JS-VM-149-FP - NETWRIX AUDITOR FOR VMWARE
21274840-27A-F-12 - CLOUD SFDC CHATTER OPTIONF 12 MONTH NW-MS-VM-29999-U-1YR - NETWRIX AUDITOR FOR VMWARE
21274840-27A-G-12 - CLOUD SFDC CHATTER OPTIONG 12 MONTH NW-MB-VM-999-U-2YR - NETWRIX AUDITOR FOR VMWARE
21274841-26A-A-12 - CLOUD SHAREPOINT OPTION BAND A 12MO NW-MB-VM-9999-U-3YR - NETWRIX AUDITOR FOR VMWARE
21274841-26A-A-24-Y1 - CLOUD SHAREPOINT OPTION BAND A 24MO YR1 NW-MS-VM-4999-U-1YR - NETWRIX AUDITOR FOR VMWARE
21274841-26A-A-24-Y2 - CLOUD SHAREPOINT OPTION BAND A 24MO YR2 NW-MS-VM-999-U-3YR - NETWRIX AUDITOR FOR VMWARE
21274841-26A-A-36-Y1 - CLOUD SHAREPOINT OPTION BAND A 36MO YR1 NW-MS-VM-29999-U-3YR - NETWRIX AUDITOR FOR VMWARE
21274841-26A-A-36-Y2 - CLOUD SHAREPOINT OPTION BAND A 36MO YR2 NW-P-VM-9999-U - NETWRIX AUDITOR FOR VMWARE
21274841-26A-A-36-Y3 - CLOUD SHAREPOINT OPTION BAND A 36MO YR3 NW-MB-VM-29999-U-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-B-12 - CLOUD SHAREPOINT OPTION BAND B 12MO NW-MS-VM-999-U-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-B-24-Y1 - CLOUD SHAREPOINT OPTION BAND B 24MO YR1 NW-MS-VM-29999-U-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-B-24-Y2 - CLOUD SHAREPOINT OPTION BAND B 24MO YR2 NW-JS-VM-9999-U-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-B-36-Y1 - CLOUD SHAREPOINT OPTION BAND B 36MO YR1 NW-JS-VM-29999-U-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-B-36-Y2 - CLOUD SHAREPOINT OPTION BAND B 36MO YR2 NW-MB-VM-4999-U-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-B-36-Y3 - CLOUD SHAREPOINT OPTION BAND B 36MO YR3 NW-MB-VM-29999-U-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-C-12 - CLOUD SHAREPOINT OPTION BAND C 12MO NW-MS-VM-149-FP-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-C-24-Y1 - CLOUD SHAREPOINT OPTION BAND C 24MO YR1 NW-MS-VM-4999-U-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-C-24-Y2 - CLOUD SHAREPOINT OPTION BAND C 24MO YR2 NW-JS-VM-149-FP-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-C-36-Y1 - CLOUD SHAREPOINT OPTION BAND C 36MO YR1 NW-MS-VM-29999-U-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-C-36-Y2 - CLOUD SHAREPOINT OPTION BAND C 36MO YR2 NW-MB-VM-149-FP-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-C-36-Y3 - CLOUD SHAREPOINT OPTION BAND C 36MO YR3 NW-MB-VM-9999-U-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-D-12 - CLOUD SHAREPOINT OPTION BAND D 12MO NW-MB-VM-9999-U-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-D-24-Y1 - CLOUD SHAREPOINT OPTION BAND D 24MO YR1 NW-MS-VM-4999-U-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-D-24-Y2 - CLOUD SHAREPOINT OPTION BAND D 24MO YR2 NW-MS-VM-9999-U-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-D-36-Y1 - CLOUD SHAREPOINT OPTION BAND D 36MO YR1 NW-JS-VM-4999-U-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-D-36-Y2 - CLOUD SHAREPOINT OPTION BAND D 36MO YR2 NW-MB-VM-999-U-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-D-36-Y3 - CLOUD SHAREPOINT OPTION BAND D 36MO YR3 NW-MB-VM-149-FP-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-E-12 - CLOUD SHAREPOINT OPTION BAND E 12MO NW-MB-VM-4999-U-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-E-24-Y1 - CLOUD SHAREPOINT OPTION BAND E 24MO YR1 NW-MB-VM-4999-U-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-E-24-Y2 - CLOUD SHAREPOINT OPTION BAND E 24MO YR2 NW-JS-VM-999-U-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-E-36-Y1 - CLOUD SHAREPOINT OPTION BAND E 36MO YR1 NW-MB-VM-9999-U-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-E-36-Y2 - CLOUD SHAREPOINT OPTION BAND E 36MO YR2 NW-MS-VM-9999-U-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-E-36-Y3 - CLOUD SHAREPOINT OPTION BAND E 36MO YR3 NW-MB-VM-999-U-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-F-12 - CLOUD SHAREPOINT OPTION BAND F 12MO NW-MB-VM-149-FP-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-F-24-Y1 - CLOUD SHAREPOINT OPTION BAND F 24MO YR1 NW-MB-VM-999-U-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-F-24-Y2 - CLOUD SHAREPOINT OPTION BAND F 24MO YR2 NW-MS-VM-999-U-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-F-36-Y1 - CLOUD SHAREPOINT OPTION BAND F 36MO YR1 NW-MS-VM-9999-U-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-F-36-Y2 - CLOUD SHAREPOINT OPTION BAND F 36MO YR2 NW-MS-VM-29999-U-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-F-36-Y3 - CLOUD SHAREPOINT OPTION BAND F 36MO YR3 NW-MB-VM-29999-U-3YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-G-12 - CLOUD SHAREPOINT OPTION BAND G 12MO NW-P-VM-29999-U - NETWRIX AUDITOR FOR VMWARE
21274841-26A-G-24-Y1 - CLOUD SHAREPOINT OPTION BAND G 24MO YR1 NW-P-VM-999-U - NETWRIX AUDITOR FOR VMWARE
21274841-26A-G-24-Y2 - CLOUD SHAREPOINT OPTION BAND G 24MO YR2 NW-MS-VM-149-FP-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-G-36-Y1 - CLOUD SHAREPOINT OPTION BAND G 36MO YR1 NW-MS-VM-4999-U-1YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-G-36-Y2 - CLOUD SHAREPOINT OPTION BAND G 36MO YR2 NW-MS-VM-999-U-2YR-PS - NETWRIX AUDITOR FOR VMWARE
21274841-26A-G-36-Y3 - CLOUD SHAREPOINT OPTION BAND G 36MO YR3 NW-MS-VM-149-FP-3YR-PS - NETWRIX AUDITOR FOR VMWARE
INCONX6HD1YR - CLOUD VIDEO CONFERENCING BRIDGE NW-P-VM-4999-U-PS - NETWRIX AUDITOR FOR VMWARE
RECYCLEIL - CLOUDBLUE CUSTOM SKU FOR ITSAVVY DISPOSAL NW-P-VM-149-FP-PS - NETWRIX AUDITOR FOR VMWARE
G7M29AAE - CLOUDERA EDH ED 1YR 24X7 E-LTU NW-P-VM-29999-U-PS - NETWRIX AUDITOR FOR VMWARE
G7M29A - CLOUDERA EDH ED 1YR 24X7 PHYS LIC NW-P-VM-9999-U-PS - NETWRIX AUDITOR FOR VMWARE
G7M31AAE - CLOUDERA EDH ED 1YR 24X7 PREMIUM E-LTU NW-MB-VM-4999-U-2YR - NETWRIX AUDITOR FOR VMWARE
G7M30AAE - CLOUDERA EDH ED 1YR 8X5 E-LTU NW-MB-VM-29999-U-2YR - NETWRIX AUDITOR FOR VMWARE
G7M30A - CLOUDERA EDH ED 1YR 8X5 PHYS LIC NW-MS-VM-9999-U-2YR - NETWRIX AUDITOR FOR VMWARE
G7M27AAE - CLOUDERA ENT BASIC ED 1YR 24X7 E-LTU NW-MB-VM-149-FP-3YR - NETWRIX AUDITOR FOR VMWARE
G7M27A - CLOUDERA ENT BASIC ED 1YR 24X7 PHYS LIC NW-HC-VM-4999-U - NETWRIX AUDITOR FOR VMWARE
G7M28AAE - CLOUDERA ENT BASIC ED 1YR 8X5 E-LTU NW-HC-VM-29999-U - NETWRIX AUDITOR FOR VMWARE
G7M28A - CLOUDERA ENT BASIC ED 1YR 8X5 PHYS LIC NW-MS-WS-4999-U-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
CF-GPS - CLOUDFORMS PROFESSIONAL SERVICES NW-P-WS-4999-U-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21197161 - CLUSTER SER FAMILY ADDL CONTACT BSC 1YR NW-P-WS-9999-U-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21197162 - CLUSTER SER FAMILY ADDL CONTACT ESS 1YR NW-MS-WS-149-FP-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227134AA01A12 - COLDFUSION ENT ADV SUP 5 USERSLEV1 NW-MS-WS-29999-U-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227107AA01A12 - COLDFUSION ENT ADV SUP 5 USERSLEV1 NW-MS-WS-149-FP-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227134AA02A12 - COLDFUSION ENT ADV SUP 5 USERSLEV2 NW-MS-WS-9999-U-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227107AA02A12 - COLDFUSION ENT ADV SUP 5 USERSLEV2 NW-MS-WS-149-FP-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227134AA03A12 - COLDFUSION ENT ADV SUP 5 USERSLEV3 NW-MB-WS-149-FP-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227107AA03A12 - COLDFUSION ENT ADV SUP 5 USERSLEV3 NW-MB-WS-9999-U-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227118AA01A12 - COLDFUSION ENT ADV SUP RNW 5 USERSLEV1 NW-MS-WS-999-U-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227131AA01A12 - COLDFUSION ENT ADV SUP RNW 5 USERSLEV1 NW-MB-WS-9999-U-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227118AA02A12 - COLDFUSION ENT ADV SUP RNW 5 USERSLEV2 NW-MS-WS-9999-U-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227131AA02A12 - COLDFUSION ENT ADV SUP RNW 5 USERSLEV2 NW-P-WS-149-FP-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227118AA03A12 - COLDFUSION ENT ADV SUP RNW 5 USERSLEV3 NW-MB-WS-999-U-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227131AA03A12 - COLDFUSION ENT ADV SUP RNW 5 USERSLEV3 NW-JS-WS-4999-U-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227110AA01A12 - COLDFUSION STD ADV SUP 5 USERSLEV1 NW-MB-WS-4999-U-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227120AA01A12 - COLDFUSION STD ADV SUP 5 USERSLEV1 NW-MB-WS-29999-U-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227110AA02A12 - COLDFUSION STD ADV SUP 5 USERSLEV2 NW-JS-WS-9999-U-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227120AA02A12 - COLDFUSION STD ADV SUP 5 USERSLEV2 NW-MB-WS-149-FP-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227120AA03A12 - COLDFUSION STD ADV SUP 5 USERSLEV3 NW-MB-WS-999-U-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227110AA03A12 - COLDFUSION STD ADV SUP 5 USERSLEV3 NW-MS-WS-29999-U-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227124AA01A12 - COLDFUSION STD ADV SUP RNW 5 USERSLEV1 NW-MS-WS-9999-U-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227116AA01A12 - COLDFUSION STD ADV SUP RNW 5 USERSLEV1 NW-JS-WS-29999-U-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227124AA02A12 - COLDFUSION STD ADV SUP RNW 5 USERSLEV2 NW-MB-WS-9999-U-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227116AA02A12 - COLDFUSION STD ADV SUP RNW 5 USERSLEV2 NW-MB-WS-4999-U-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227124AA03A12 - COLDFUSION STD ADV SUP RNW 5 USERSLEV3 NW-MB-WS-29999-U-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
65227116AA03A12 - COLDFUSION STD ADV SUP RNW 5 USERSLEV3 NW-MS-WS-4999-U-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN01MAINT - COM CS/SNAGIT WIN MAINT 1 USER NW-MS-WS-29999-U-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN14MAINT - COM CS/SNAGIT WIN MAINT 10-14 USER NW-P-WS-999-U-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN199MAINT - COM CS/SNAGIT WIN MAINT 100-199 USER NW-P-WS-29999-U-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN24MAINT - COM CS/SNAGIT WIN MAINT 15-24 USER NW-P-WS-29999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN49MAINT - COM CS/SNAGIT WIN MAINT 25-49 USER NW-MS-WS-4999-U-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN09MAINT - COM CS/SNAGIT WIN MAINT 5-9 USER NW-MS-WS-149-FP-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN99MAINT - COM CS/SNAGIT WIN MAINT 50 99 USER NW-JS-WS-29999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN01REN - COM CS/SNAGIT WIN MAINT REN 1 USER NW-HC-WS-149-FP - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN14REN - COM CS/SNAGIT WIN MAINT REN 10-14 USER NW-MS-WS-9999-U-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN199REN - COM CS/SNAGIT WIN MAINT REN 100-199 USER NW-MS-WS-4999-U-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN24REN - COM CS/SNAGIT WIN MAINT REN 15-24 USER NW-JS-WS-9999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN49REN - COM CS/SNAGIT WIN MAINT REN 25-49 USER NW-MB-WS-29999-U-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN09REN - COM CS/SNAGIT WIN MAINT REN 5-9 USER NW-MB-WS-149-FP-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CSBN99REN - COM CS/SNAGIT WIN MAINT REN 50 99 USER NW-MB-WS-4999-U-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
RELAY1MAINT - COM RELAY MAINT 1 SERVER 1 ENCODING NW-MS-WS-149-FP-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
RELAY3MAINT - COM RELAY MAINT 1 SERVER 3 ENCODING NW-MS-WS-9999-U-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
RELAY7MAINT - COM RELAY MAINT 1 SERVER 7 ENCODING NW-P-WS-9999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
RELAY1REN - COM RELAY MAINT REN 1 SERVER 1 ENCODING NW-MB-WS-999-U-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
RELAY3REN - COM RELAY MAINT REN 1 SERVER 3 ENCODING NW-MB-WS-9999-U-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
RELAY7REN - COM RELAY MAINT REN 1 SERVER 7 ENCODING NW-MB-WS-9999-U-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
21197173 - COMMDCENTL FAMILY ADDL CONTACT BSC 1YR NW-MS-WS-4999-U-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
21197174 - COMMDCENTL FAMILY ADDL CONTACT ESS 1YR NW-MB-WS-999-U-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CMAC09MAINT - COMMERCIAL CAMTASIA FOR MAC MAINTENANCE NW-MS-WS-29999-U-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CMAC199MAINT - COMMERCIAL CAMTASIA FOR MAC MAINTENANCE NW-MS-WS-9999-U-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CMAC99MAINT - COMMERCIAL CAMTASIA FOR MAC MAINTENANCE NW-JS-WS-4999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CMAC49MAINT - COMMERCIAL CAMTASIA FOR MAC MAINTENANCE NW-HC-WS-999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CMAC14MAINT - COMMERCIAL CAMTASIA FOR MAC MAINTENANCE NW-HC-WS-9999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CMAC24MAINT - COMMERCIAL CAMTASIA FOR MAC MAINTENANCE NW-MB-WS-149-FP-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CMAC01MAINT - COMMERCIAL CAMTASIA FOR MAC MAINTENANCE NW-MB-WS-4999-U-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CAMS199MAINT - COMMERCIAL CAMTASIA STUDIO WINDOWS MAIN NW-MB-WS-29999-U-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
SNAG5999MAINT - COMMERCIAL SNAGIT-9 MAINTENANCE NW-MS-WS-149-FP-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
SNAG4499MAINT - COMMERCIAL SNAGIT-9 MAINTENANCE 3K-4499 NW-MB-WS-149-FP-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
0C47143 - COMPLETE SECURITY SUITE -50-99 USERS -12 MOS NW-MB-WS-4999-U-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
7015471-7017626-ENT - COMPRESSION FYM ENT SUPRT NW-MB-WS-29999-U-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
7015470-7017626-STD - COMPRESSION FYM STD SUPRT NW-HC-WS-4999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
VMVS - COMPUTER ATLANTA VMWARE VSPHERE NW-HC-WS-29999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-COMMAP-12 - COMPUTRACE COMPLETE 1YR COMMUNITY ACTION ONLY NW-P-WS-999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-WAREED-24 - COMPUTRACE COMPLETE 2Y WADDELL AND REED ONLY NW-P-WS-149-FP - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-WAREED-36 - COMPUTRACE COMPLETE 3 YR WADDELL AND REED ONLY NW-P-WS-4999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-KINGSL-36 - COMPUTRACE COMPLETE 3YR UPGRADE TERM FOR 7 LICENSES KINGSLEY ONLY NW-MB-WS-9999-U-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-WARA-36 - COMPUTRACE COMPLETE 3YR WADDELL AND REED ONLY NW-MS-WS-999-U-1YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-RTG-48 - COMPUTRACE COMPLETE 4YR FOR RTG ONLY NW-MS-WS-999-U-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-CARDTR-36 - COMPUTRACE COMPLETE CARDTRONICS 3YR SKU NW-JS-WS-149-FP - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-CATR-36 - COMPUTRACE COMPLETE CARDTRONICS ONLY BUYBACK SCENERIO NW-MS-WS-29999-U-2YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-OPENLN-24 - COMPUTRACE COMPLETE OPENLANE 2YR SKU NW-MB-WS-999-U-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CTC-GD-SUNY-12 - COMPUTRACE COMPLETE SUNY ORANGE COUNTY 1 YR ONLY NW-MS-WS-999-U-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
CDP-GD-HEARES-12 - COMPUTRACE DATA PROTECTION 1YR FOR HEALTH RECOVERY SERVICES NW-MS-WS-29999-U-3YR - NETWRIX AUDITOR FOR WINDOWS SERVER
PS-GUITAR-KSLITE - COMPUTRACE PROFESSIONAL SERVICES KICK START LIGHT NW-JS-WS-999-U - NETWRIX AUDITOR FOR WINDOWS SERVER
CDP-GD-GSI2-36 - COMPUTRACEDATAPROTECTION NW-MB-WS-4999-U-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
CPTS-PRO-CON-5D - CONSULTING SERVICES - 5 DAYS BUNDLE NW-MB-WS-29999-U-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
124967-PM - CONSULTING, PROJECT MANAGEMENT PER DAY NW-MB-WS-999-U-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21197169 - CONTROL COMP FAMILY ADDL CONTACT BSC 1YR NW-JS-WS-999-U-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21197170 - CONTROL COMP FAMILY ADDL CONTACT ESS 1YR NW-MS-WS-4999-U-2YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21210969-27A-A-12 - CONTROL.CLOUD BAND A 12 MONTH NW-MB-WS-149-FP-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21210969-27A-B-12 - CONTROL.CLOUD BAND B 12 MONTH NW-MS-WS-999-U-3YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21210969-27A-C-12 - CONTROL.CLOUD BAND C 12 MONTH NW-JS-WS-149-FP-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21210969-27A-D-12 - CONTROL.CLOUD BAND D 12 MONTH NW-MS-WS-999-U-1YR-PS - NETWRIX AUDITOR FOR WINDOWS SERVER
21210969-27A-E-12 - CONTROL.CLOUD BAND E 12 MONTH NW-MB-IDM-149-FP-1YR-PS - NETWRIX IDENTITY MANAGEMENT SUITE
21210969-27A-F-12 - CONTROL.CLOUD BAND F 12 MONTH NW-MS-IDM-999-U-1YR-PS - NETWRIX IDENTITY MANAGEMENT SUITE
21210969-27A-G-12 - CONTROL.CLOUD BAND G 12 MONTH NW-MS-IDM-9999-U-1YR-PS - NETWRIX IDENTITY MANAGEMENT SUITE
INCONX12HD1YR - CONX CLOUD VIDEO CONFERENCING BRIDGE NW-MB-IDM-4999-U-2YR-PS - NETWRIX IDENTITY MANAGEMENT SUITE
TSPES5 - Corel - Premium Enterprise Support 5 pack NW-MB-IDM-29999-U-3YR-PS - NETWRIX IDENTITY MANAGEMENT SUITE
TSPES10 - Corel - Premium Service Enterprise - Technical support - phone consulting - 1 ye NW-MS-IDM-999-U-3YR-PS - NETWRIX IDENTITY MANAGEMENT SUITE
LCPTRML1PCMMNA1 - COREL PAINTER EDU MAINT (1 YR) SINGLE ML NW-JS-IDM-999-U-PS - NETWRIX IDENTITY MANAGEMENT SUITE
LCCDTSMLPCMNT25 - CORELDRAW TECHNICAL SUITE MAINT (2 YRS) NW-JS-IDM-9999-U-PS - NETWRIX IDENTITY MANAGEMENT SUITE
LCDESMLPCMNT25 - CORELDRAW TECHNICAL SUITE MAINT (2 YRS) NW-MB-IDM-29999-U-1YR - NETWRIX IDENTITY MANAGEMENT SUITE
LCCDTSX6MLUG5 - CORELDRAW TECHNICAL SUITE X6 UPGRADE LIC NW-MS-IDM-999-U-1YR - NETWRIX IDENTITY MANAGEMENT SUITE
COTERM294392-1 - COTERM QUOTE 294392-1 FOR PIONEER NATURAL RESOURCES. END DATE: DEC-31-2014 NW-MB-IDM-9999-U-1YR - NETWRIX IDENTITY MANAGEMENT SUITE
COTERM297346-3 - COTERM QUOTE 297346-3 FOR GEORGE WEISS ASSOCIATES. END DATE: JAN-22-2015 NW-MB-IDM-9999-U-2YR - NETWRIX IDENTITY MANAGEMENT SUITE
COTERM299433-2 - COTERM QUOTE 299433-2 FOR SUNOVION. END DATE: MAR-31-2015 NW-MB-IDM-149-FP-3YR - NETWRIX IDENTITY MANAGEMENT SUITE
COTERM314149-1 - COTERM QUOTE 314149-1 FOR ROXBURY COMMUNITY COLLEGE. END DATE: MAR-02-2015 NW-MS-IDM-149-FP-3YR - NETWRIX IDENTITY MANAGEMENT SUITE
COTERM314173-1 - COTERM QUOTE 314173-1 FOR ROXBURY COMMUNITY COLLEGE. END DATE: MAR-02-2015 NW-MS-IDM-4999-U-3YR - NETWRIX IDENTITY MANAGEMENT SUITE
COTERM-346736-1 - COTERM QUOTE 346736-1 FOR STATE OF LOUISIANA / OT. END DATE: JUN-30-2015 NW-JS-IDM-29999-U - NETWRIX IDENTITY MANAGEMENT SUITE
COTERM-350541-1 - COTERM QUOTE 350541-1 FOR SHREWSBURY PUBLIC SCHOOLS NW-P-IDM-149-FP - NETWRIX IDENTITY MANAGEMENT SUITE
CPX-2014-US-REG - CPX US 2014 REGISTRATION (WITHOUT HOTEL)