NEW - WESTERN DIGITAL 250GB 7200RPM SATA II 3.5INCH DESKTOP HARD DRIVE
Home ยป Shop by Manufacturer
Search Thousands of Computer Products Search Thousands of Computer Products

MICROSOFT

810-04924 - SQL SVR ENTERPRISE EDTN WIN32 ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD EJF-00990 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
125-00265 - VISUAL STDIO FOUNDATN SVR ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD EJF-01059 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
HJA-01007 - 2013R2 ENG OLP 2LIC NL LCLGOV CORELIC EJF-00895 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
HJA-00985 - 2013R2 SNGL OLP 2LIC C CORELIC EJF-01163 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
HJA-00986 - 2013R2 SNGL OLP 2LIC NL CORELIC QLFD EJF-01429 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3GZ-00001 - 3GZ-00001-12 EJF-01491 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3GZ-00002 - 3GZ-00002-12 EJF-00914 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3HZ-00001 - 3HZ-00001-12 EJF-01061 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3HZ-00002 - 3HZ-00002-12 EJF-00916 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3HZ-00004 - 3HZ-00004-12 EJF-01058 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3HZ-00005 - 3HZ-00005-12 EJF-01565 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3LN-00001 - 3LN-00001-12 EJF-00991 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3LN-00002 - 3LN-00002-12 EJF-00992 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
3LN-00004 - 3LN-00004-12 EJF-00993 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
5FV-00002 - 5FV-00002-12 EJF-01165 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
5FV-00004 - 5FV-00004-12 EJF-01431 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
5FV-00007 - 5FV-00007-12 EJF-00894 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
5FV-00008 - 5FV-00008-12 EJF-00915 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
5FV-00009 - 5FV-00009-12 EJF-01465 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
5FV-00010 - 5FV-00010-12 EJF-01564 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
AAA-01147 - ACCESS 2013 - BUILD A DATABASE FAST TO ORGANIZE DATA, ACCESSIBLE ANYWHERE ONLINE EJF-00896 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SNGL SOFTWARE ASSURANCE OPEN VALUE 1 LIC
AAA-01148 - ACCESS 2013 - BUILD A DATABASE FAST TO ORGANIZE DATA, ACCESSIBLE ANYWHERE ONLINE EJF-01529 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-06368 - ACCESS 2013 32-BIT/X64 ENGLISH MEDIALESS EJF-01071 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-06693 - ACCESS 2013 ENG OLP NL LCLGOV EJF-01534 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-06673 - ACCESS 2013 SNGL OLP C EJF-01585 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-06674 - ACCESS 2013 SNGL OLP NL EJF-01191 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-03627 - ACCESS ALL LNG LIC/SA PK OLV NL 1YR ADDT EJF-01190 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-05652 - ACCESS ALNG LICSAPK OLV C 1Y AP EJF-01086 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-05318 - ACCESS ALNG LICSAPK OLV D 1Y AP EJF-01099 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-03495 - ACCESS ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD EJF-01078 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-03499 - ACCESS ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD EJF-01543 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-03500 - ACCESS ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD EJF-01070 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-03504 - ACCESS ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD EJF-01042 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-02524 - Access For Windows Standard Edition Software Assurance 32-Bit Win License Only N EJF-01584 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-02658 - Access For Windows Standard Edition Software Assurance 32-Bit Win License Only N EJF-01528 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-02523 - Access For Windows Standard Edition Software Assurance 32-Bit Win License Only N EJF-01087 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-02657 - Access For Windows Standard Edition Software Assurance 32-Bit Win License Only N EJF-01519 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-02491 - Access For Windows Standard Edition Software Assurance 32-Bit Win License Only N EJF-01518 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-02645 - Access For Windows Standard Edition Software Assurance 32-Bit Win License Only N EJF-01617 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-03496 - ACCESSENGLISHLIC/SAPACKOLVNL1YRACQY2ADDT EJF-01043 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-03497 - ACCESSENGLISHLIC/SAPACKOLVNL1YRACQY3ADDT EJF-01616 - MICROSOFT WINDOWS MULTIPOINT SERVER CAL SOFTWARE ASSURANCE OPEN VALUE 1 LICENSE
077-03498 - ACCESSENGLISHLIC/SAPACKOLVNL2YRACQY2ADDT V7J-00201 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM LICENSE/SOFTWARE ASSURANCE PACK OPEN
077-03502 - ACCESSENGLISHSAOLVNL1YRACQY2ADDTLPROD V7J-00195 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM LICENSE/SOFTWARE ASSURANCE PACK OPEN
077-03503 - ACCESSENGLISHSAOLVNL2YRACQY2ADDTLPROD V7J-00217 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM LICENSE/SOFTWARE ASSURANCE PACK OPEN
077-05309 - ACCESSLICSAPKOLVD1YAQY1AP V7J-00306 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM LICENSE/SOFTWARE ASSURANCE PACK OPEN
077-05331 - ACCESSLICSAPKOLVD1YAQY2AP V7J-00329 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM LICENSE/SOFTWARE ASSURANCE PACK OPEN
077-05310 - ACCESSLICSAPKOLVD1YAQY3AP V7J-00330 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SA STEP UP OPEN VALUE 1 LICENSE LEVE
077-05311 - ACCESSLICSAPKOLVD2YAQY2AP V7J-00202 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SA STEP UP OPEN VALUE 1 LICENSE LEVE
077-05312 - ACCESSLICSAPKOLVD3YAQY1AP V7J-00683 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SA STEP UP OPEN VALUE 1 LICENSE LEVE
077-05313 - ACCESSSAOLVD1YAQY1AP V7J-00218 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SA STEP UP OPEN VALUE 1 LICENSE LEVE
077-05315 - ACCESSSAOLVD1YAQY2AP V7J-00196 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SA STEP UP OPEN VALUE 1 LICENSE LEVE
077-05314 - ACCESSSAOLVD1YAQY3AP V7J-00158 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05316 - ACCESSSAOLVD2YAQY2AP V7J-00157 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05317 - ACCESSSAOLVD3YAQY1AP V7J-00294 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05602 - ACCESSSNGLLICSAPKOLVC1YAQY1AP V7J-00156 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05624 - ACCESSSNGLLICSAPKOLVC1YAQY2AP V7J-00260 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05646 - ACCESSSNGLLICSAPKOLVC1YAQY3AP V7J-00282 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05670 - ACCESSSNGLLICSAPKOLVC2YAQY2AP V7J-00167 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05692 - ACCESSSNGLLICSAPKOLVC3YAQY1AP V7J-00281 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05603 - ACCESSSNGLSAOLVC1YAQY1AP V7J-00259 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05625 - ACCESSSNGLSAOLVC1YAQY2AP V7J-00295 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL LICENSE/SOFTWARE ASSURANCE PACK
077-05647 - ACCESSSNGLSAOLVC1YAQY3AP V7J-00159 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
077-05671 - ACCESSSNGLSAOLVC2YAQY2AP V7J-00097 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
077-05693 - ACCESSSNGLSAOLVC3YAQY1AP V7J-00261 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
G10-00025 - Age of Empires III - Complete package - 1 user - CD-ROM (DVD-box) - Win - Englis V7J-00169 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
RJX-00018 - AGE OF EMPIRES III GOLD WIN32 SPANISHCD V7J-00168 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
AYB-00034 - AGEOFEMPIRESIII:CMPLT COL WIN32 ENGLISH V7J-00160 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
3VU-00076 - ALNG LICSAPK OLP C V7J-00296 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
3VU-00091 - ALNG LICSAPK OLP NL LCLGOV QLFD V7J-00307 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
3VU-00077 - ALNG LICSAPK OLP NL QLFD V7J-00283 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
3VU-00079 - ALNG SA OLP NL QLFD V7J-00284 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SA STEP UP OPEN VALUE 1 LICENSE
CW2-00057 - ALNG SA OLV C 1Y AQY1 ENT V7J-00309 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00067 - ALNG SA OLV C 1Y AQY1 PLTFRM V7J-00286 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00153 - ALNG SA OLV C 3Y AQY1 ENT V7J-00308 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00162 - ALNG SA OLV C 3Y AQY1 PLTFRM V7J-00162 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00093 - ALNG SA OLV D 1Y AQY1 ENT V7J-00171 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00106 - ALNG SA OLV D 1Y AQY1 PLTFRM V7J-00285 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00172 - ALNG SA OLV D 3Y AQY1 ENT V7J-00170 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00174 - ALNG SA OLV D 3Y AQY1 PLTFRM V7J-00099 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00058 - ALNG SA OLV NL 1Y AQY1 ENT V7J-00098 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00068 - ALNG SA OLV NL 1Y AQY1 PLTFRM V7J-00161 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SNGL SOFTWARE ASSURANCE OPEN VALUE 1
CW2-00154 - ALNG SA OLV NL 3Y AQY1 ENT V7J-00203 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SOFTWARE ASSURANCE OPEN VALUE 1 LICE
CW2-00164 - ALNG SA OLV NL 3Y AQY1 PLTFRM V7J-00197 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SOFTWARE ASSURANCE OPEN VALUE 1 LICE
CW2-00059 - ALNG UPGRDSAPK OLV C 1Y AQY1 ENT V7J-00331 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SOFTWARE ASSURANCE OPEN VALUE 1 LICE
CX2-00027 - ALNG UPGRDSAPK OLV C 1Y AQY1 PLTFRM V7J-00219 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SOFTWARE ASSURANCE OPEN VALUE 1 LICE
CW2-00069 - ALNG UPGRDSAPK OLV C 1Y AQY1 PLTFRM V7J-00684 - MICROSOFT WINDOWS MULTIPOINT SERVER PREMIUM SOFTWARE ASSURANCE OPEN VALUE 1 LICE
CW2-00061 - ALNG UPGRDSAPK OLV C 1Y AQY2 ENT V6J-00324 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD LICENSE/SOFTWARE ASSURANCE PACK OPE
CW2-00071 - ALNG UPGRDSAPK OLV C 1Y AQY2 PLTFRM V6J-00208 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD LICENSE/SOFTWARE ASSURANCE PACK OPE
CX2-00029 - ALNG UPGRDSAPK OLV C 1Y AQY2 PLTFRM V6J-00328 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD LICENSE/SOFTWARE ASSURANCE PACK OPE
CW2-00063 - ALNG UPGRDSAPK OLV C 1Y AQY3 ENT V6J-00320 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD LICENSE/SOFTWARE ASSURANCE PACK OPE
CX2-00031 - ALNG UPGRDSAPK OLV C 1Y AQY3 PLTFRM V6J-00146 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD LICENSE/SOFTWARE ASSURANCE PACK OPE
CW2-00073 - ALNG UPGRDSAPK OLV C 1Y AQY3 PLTFRM V6J-00127 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00065 - ALNG UPGRDSAPK OLV C 1Y ENT V6J-00126 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00075 - ALNG UPGRDSAPK OLV C 1Y PLTFRM V6J-00348 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00077 - ALNG UPGRDSAPK OLV C 1Y PLTFRMUTD V6J-00188 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00079 - ALNG UPGRDSAPK OLV C 1Y UTD V6J-00288 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00161 - ALNG UPGRDSAPK OLV C 2Y AQY2 ENT V6J-00297 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00170 - ALNG UPGRDSAPK OLV C 2Y AQY2 PLTFRM V6J-00298 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CX2-00056 - ALNG UPGRDSAPK OLV C 2Y AQY2 PLTFRM V6J-00209 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00155 - ALNG UPGRDSAPK OLV C 3Y AQY1 ENT V6J-00299 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00165 - ALNG UPGRDSAPK OLV C 3Y AQY1 PLTFRM V6J-00349 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CX2-00077 - ALNG UPGRDSAPK OLV C 3Y AQY1 PLTFRM V6J-00199 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL LICENSE/SOFTWARE ASSURANCE PAC
CW2-00094 - ALNG UPGRDSAPK OLV D 1Y AQY1 ENT V6J-00201 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CX2-00051 - ALNG UPGRDSAPK OLV D 1Y AQY1 PLTFRM V6J-00351 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CW2-00107 - ALNG UPGRDSAPK OLV D 1Y AQY1 PLTFRM V6J-00310 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CW2-00095 - ALNG UPGRDSAPK OLV D 1Y AQY2 ENT V6J-00301 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CW2-00108 - ALNG UPGRDSAPK OLV D 1Y AQY2 PLTFRM V6J-00200 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CX2-00052 - ALNG UPGRDSAPK OLV D 1Y AQY2 PLTFRM V6J-00309 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CW2-00096 - ALNG UPGRDSAPK OLV D 1Y AQY3 ENT V6J-00350 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CW2-00109 - ALNG UPGRDSAPK OLV D 1Y AQY3 PLTFRM V6J-00139 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CX2-00053 - ALNG UPGRDSAPK OLV D 1Y AQY3 PLTFRM V6J-00128 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CW2-00097 - ALNG UPGRDSAPK OLV D 1Y ENT V6J-00300 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SNGL SOFTWARE ASSURANCE OPEN VALUE
CW2-00110 - ALNG UPGRDSAPK OLV D 1Y PLTFRM V6J-00325 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SOFTWARE ASSURANCE OPEN VALUE 1 LIC
CW2-00111 - ALNG UPGRDSAPK OLV D 1Y PLTFRMUTD V6J-00147 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SOFTWARE ASSURANCE OPEN VALUE 1 LIC
CW2-00113 - ALNG UPGRDSAPK OLV D 1Y UTD V6J-00219 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SOFTWARE ASSURANCE OPEN VALUE 1 LIC
CW2-00122 - ALNG UPGRDSAPK OLV D 2Y AQY2 ENT V6J-00339 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SOFTWARE ASSURANCE OPEN VALUE 1 LIC
CW2-00124 - ALNG UPGRDSAPK OLV D 2Y AQY2 PLTFRM V6J-00321 - MICROSOFT WINDOWS MULTIPOINT SERVER STANDARD SOFTWARE ASSURANCE OPEN VALUE 1 LIC
CX2-00066 - ALNG UPGRDSAPK OLV D 2Y AQY2 PLTFRM FQC-06913 - MICROSOFT WINDOWS PROFESSIONAL 8.1 32-BIT/64-BIT ENGLISH 1 LICENSE DVD
CW2-00173 - ALNG UPGRDSAPK OLV D 3Y AQY1 ENT FQC-04146 - MICROSOFT WINDOWS PROFESSIONAL SNGL UPGRADE/SOFTWARE ASSURANCE PACK OPEN VALUE 1
CW2-00175 - ALNG UPGRDSAPK OLV D 3Y AQY1 PLTFRM R18-01063 - MICROSOFT WINDOWS SERVER 2003 LICENSE 5 CLIENTS OEM
CW2-00060 - ALNG UPGRDSAPK OLV NL 1Y AQY1 ENT R18-00143 - MICROSOFT WINDOWS SERVER 2003 CLIENT ACCESS LICENCE 1 CAL W/ ASSURANCE
CX2-00028 - ALNG UPGRDSAPK OLV NL 1Y AQY1 PLTFRM LSA-00079 - Microsoft Windows Server 2008 Enterprise without Hyper-V 25 CAL
CW2-00070 - ALNG UPGRDSAPK OLV NL 1Y AQY1 PLTFRM P72-02906 - Microsoft Windows Server Enterprise 2008 25 Client Retail
CW2-00062 - ALNG UPGRDSAPK OLV NL 1Y AQY2 ENT K6W-00184 - MICROSOFT WINDOWS STORE GIFT CARD $10
CW2-00072 - ALNG UPGRDSAPK OLV NL 1Y AQY2 PLTFRM K6W-00185 - MICROSOFT WINDOWS STORE GIFT CARD $100
CX2-00030 - ALNG UPGRDSAPK OLV NL 1Y AQY2 PLTFRM K6W-00190 - MICROSOFT WINDOWS STORE GIFT CARD $15
CW2-00064 - ALNG UPGRDSAPK OLV NL 1Y AQY3 ENT K6W-00195 - MICROSOFT WINDOWS STORE GIFT CARD $20
CW2-00074 - ALNG UPGRDSAPK OLV NL 1Y AQY3 PLTFRM K6W-00200 - MICROSOFT WINDOWS STORE GIFT CARD $25
CX2-00032 - ALNG UPGRDSAPK OLV NL 1Y AQY3 PLTFRM K6W-00206 - MICROSOFT WINDOWS STORE GIFT CARD $50
CW2-00066 - ALNG UPGRDSAPK OLV NL 1Y ENT 5MH-00001 - MICROSOFT WIRED DESKTOP 400 FOR BUSINESS USB PORT ENGLISH NORTH AMERICA 1 LICENS
CW2-00076 - ALNG UPGRDSAPK OLV NL 1Y PLTFRM 6JH-00026 - MICROSOFT WIRED KEYBOARD 200 FOR BUSINESS USB PORT ENGLISH NORTH AMERICA 1 LICEN
CW2-00078 - ALNG UPGRDSAPK OLV NL 1Y PLTFRMUTD 6JH-00001 - MICROSOFT WIRED KEYBOARD 200 FOR BUSINESS USB PORT ENGLISH NORTH AMERICA 1 LICEN
CW2-00080 - ALNG UPGRDSAPK OLV NL 1Y UTD M7J-00001 - MICROSOFT WIRELESS DESKTOP 2000 USB PORT ENGLISH NORTH AMERICA 1 LICENSE
CW2-00163 - ALNG UPGRDSAPK OLV NL 2Y AQY2 ENT 5SH-00001 - MICROSOFT WIRELESS DESKTOP 800 FOR BUSINESS USB PORT ENGLISH NORTH AMERICA 1 LIC
CX2-00057 - ALNG UPGRDSAPK OLV NL 2Y AQY2 PLTFRM m03-00041 - MICROSOFT WIRELESS INTELLIMOUSE EXPLORER 2.0 MOUSE RETAIL
CW2-00112 - ALNG UPGRDSAPK OLV NL 2Y AQY2 PLTFRM E6K-00001 - MICROSOFT WIRELESS KEYBOARD 2000 USB PORT ENGLISH NORTH AMERICA 1 LICENSE
CW2-00157 - ALNG UPGRDSAPK OLV NL 3Y AQY1 ENT 2VJ-00001 - MICROSOFT WIRELESS KEYBOARD 800 USB PORT ENGLISH NORTH AMERICA 1 LICENSE SPECIAL
CW2-00166 - ALNG UPGRDSAPK OLV NL 3Y AQY1 PLTFRM 2CF-00002 - MICROSOFT WIRELESS MOBILE MOUSE 1000 MAC/WIN USB PORT EN/XC/FR/EL/IW/IT/PT/ES 1
CX2-00078 - ALNG UPGRDSAPK OLV NL 3Y AQY1 PLTFRM 2CF-00036 - MICROSOFT WIRELESS MOBILE MOUSE 1000 MAC/WIN USB PORT ENGLISH 1 LICENSE PRICE DI
73F-00021 - ANTIGEN ENTERPRISE MANAGR ENGLISH MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD SERV 2CF-00031 - MICROSOFT WIRELESS MOBILE MOUSE 1000 MAC/WIN USB PORT ENGLISH 1 LICENSE PRICE DI
73F-00021 - ANTIGEN ENTERPRISE MANAGR ENGLISH MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD SERV 2CF-00041 - MICROSOFT WIRELESS MOBILE MOUSE 1000 MAC/WIN USB PORT ENGLISH 1 LICENSE PRICE DI
56J-00112 - ANTIGEN INSTNT MSGING ALL LNG MONTHLY SUBSCRIPTION MVL PER DEVICE U7Z-00001 - MICROSOFT WIRELESS MOBILE MOUSE 1850 WIN7/8 EN/XC/XX AMER 1 LICENSE BLACK
73F-00020 - ANTIGENENTMGR ALNG SUBSVL 1MTH AP SRVCS U7Z-00031 - MICROSOFT WIRELESS MOBILE MOUSE 1850 WIN7/8 EN/XC/XX AMER 1 LICENSE FLAME RED V2
73F-00020 - ANTIGENENTMGR ALNG SUBSVL 1MTH AP SRVCS U7Z-00021 - MICROSOFT WIRELESS MOBILE MOUSE 1850 WIN7/8 EN/XC/XX AMER 1 LICENSE LIGHT ORCHID
73F-00039 - ANTIGENENTMGR ALNG SUBSVL OLV C 1MTH AP U7Z-00041 - MICROSOFT WIRELESS MOBILE MOUSE 1850 WIN7/8 EN/XC/XX AMER 1 LICENSE PURPLE
73F-00039 - ANTIGENENTMGR ALNG SUBSVL OLV C 1MTH AP U7Z-00011 - MICROSOFT WIRELESS MOBILE MOUSE 1850 WIN7/8 EN/XC/XX AMER 1 LICENSE WOOL BLUE
73F-00033 - ANTIGENENTMGR ALNG SUBSVL OLV D 1MTH AP GMF-00273 - MICROSOFT WIRELESS MOBILE MOUSE 3500 MAC/WIN USB PORT EN/XC/XX 1 LICENSE PRICE D
73F-00033 - ANTIGENENTMGR ALNG SUBSVL OLV D 1MTH AP GMF-00278 - MICROSOFT WIRELESS MOBILE MOUSE 3500 MAC/WIN USB PORT EN/XC/XX 1 LICENSE PRICE D
73F-00040 - ANTIGENENTMGRSNGLSUBSVLOLVC1MTHAP GMF-00176 - MICROSOFT WIRELESS MOBILE MOUSE 3500 MAC/WIN USB PORT ENGLISH,SPANISH 1 LICENSE
73F-00040 - ANTIGENENTMGRSNGLSUBSVLOLVC1MTHAP D5D-00001 - Microsoft Wireless Mobile Mouse 4000 Graphite
73F-00034 - ANTIGENENTMGRSUBSVLOLVD1MTHAPSRVCS D48-01080 - MICROSOFT WORD MAC 2011 ENGLISH LOCAL GOVERNMENT OPEN 1 LICENSE NO LEVEL
73F-00034 - ANTIGENENTMGRSUBSVLOLVD1MTHAPSRVCS D48-01058 - MICROSOFT WORD MAC 2011 SNGL OPEN 1 LICENSE LEVEL C
ZJA-00001 - ARC MOUSE MAC/WIN USB PORT ENGLISH HDWR D48-01060 - MICROSOFT WORD MAC 2011 SNGL OPEN 1 LICENSE NO LEVEL
689-00741 - AUTOROUTE EURO ALL LNG LIC/SA PK OLV NL CSD-00024 - MICROSOFT WRLS COMFORT DSKTP 5000 USB PORT ENGLISH NORTH AMERICA 1 LICENSE US ON
689-00723 - AutoRoute Euro English Lic/SA Pack OLP NL Locl Govt 5RH-00003 - MICROSOFT WRLS MOBILE MOUSE 3500 FOR BUSINESS MAC/WIN USB PORT EN/XC/FR/EL/IW/IT
689-00744 - AUTOROUTE EURO ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD 52A-00004 - MICROSOFT XBOX 360 COMMON CONTROLLER WINXP USB PORT ENGLISH,FRENCH,SPANISH 1 LIC
689-00752 - AUTOROUTE EURO ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD JR9-00011 - MICROSOFT XBOX360 WRLS COMMON CONTROLLER WIN USB PORT ENGLISH,FRENCH,SPANISH AME
689-00710 - AutoRoute Euro English SA OLP NL Locl Govt P58-00061 - MICROSOFTBASIC OPTICAL MOUSE MAC/WIN USB EN/XC/XX 1 LICENSE BLACK
689-00731 - AUTOROUTE EURO ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD P58-00062 - MICROSOFTBASIC OPTICAL MOUSE MAC/WIN USB EN/XC/XX 1 LICENSE WHITE
689-00739 - AUTOROUTE EURO ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD U2V-00006 - MICROSOFTBING MAPS ENTERPRISE PLATFORM MONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN
689-00381 - AutoRoute Euro Win32 English Lic/SA Pack OLP C U2V-00006 - MICROSOFTBING MAPS ENTERPRISE PLATFORM MONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN
689-00386 - AutoRoute Euro Win32 English Lic/SA Pack OLP NL U2V-00004 - MICROSOFTBING MAPS ENTERPRISE PLATFORMMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN V
689-00433 - AutoRoute Euro Win32 English SA OLP C U2V-00004 - MICROSOFTBING MAPS ENTERPRISE PLATFORMMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN V
689-00438 - AutoRoute Euro Win32 English SA OLP NL T6V-00002 - MICROSOFTBING MAPS INTERNAL WEBSITEMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALU
689-01191 - AUTOROUTEEURO 2013 ENG OLP NL LCLGOV T6V-00002 - MICROSOFTBING MAPS INTERNAL WEBSITEMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALU
689-01184 - AUTOROUTEEURO 2013 SNGL OLP NL T3V-00006 - MICROSOFTBING MAPS KNOWN USER MONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE 1 L
689-01026 - AUTOROUTEEURO ALNG LICSAPK OLV C 1Y AP T3V-00006 - MICROSOFTBING MAPS KNOWN USER MONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE 1 L
689-00989 - AUTOROUTEEURO ALNG LICSAPK OLV D 1Y AP T3V-00004 - MICROSOFTBING MAPS KNOWN USERMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE 1 LI
689-00746 - AUTOROUTEEUROENGLICSAPACKOLVNL1YRACQY2AD T3V-00004 - MICROSOFTBING MAPS KNOWN USERMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE 1 LI
689-00750 - AUTOROUTEEUROENGLICSAPACKOLVNL2YRACQY2AD T5V-00012 - MICROSOFTBING MAPS LIGHT KNOWN USERMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALU
689-00737 - AUTOROUTEEUROENGSAOLVNL2YRACQY2ADDTLPROD T9V-00004 - MICROSOFTBING MAPS PUBLIC WEBSITEMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE
689-00991 - AUTOROUTEEUROLICSAPKOLVD1YAQY1AP T9V-00024 - MICROSOFTBING MAPS PUBLIC WEBSITEMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE
689-00992 - AUTOROUTEEUROLICSAPKOLVD1YAQY2AP T9V-00024 - MICROSOFTBING MAPS PUBLIC WEBSITEMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE
689-00993 - AUTOROUTEEUROLICSAPKOLVD1YAQY3AP T9V-00004 - MICROSOFTBING MAPS PUBLIC WEBSITEMONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE
689-00994 - AUTOROUTEEUROLICSAPKOLVD2YAQY2AP 9F5-00001 - MICROSOFTOFFICE365BUSINESSESSENTIALSOPEN SHRDSVR SNGL MONTHLYSUBSCRIPTIONS-VOLUM
689-00995 - AUTOROUTEEUROLICSAPKOLVD3YAQY1AP J29-00001 - MICROSOFTOFFICE365BUSINESSOPEN SHRDSVR SNGL MONTHLYSUBSCRIPTIONS-VOLUMELICENSE O
689-00984 - AUTOROUTEEUROSAOLVD1YAQY1AP 9F4-00001 - MICROSOFTOFFICE365BUSINESSPREMIUMOPEN SHRDSVR SNGL MONTHLYSUBSCRIPTIONS-VOLUMELI
689-00985 - AUTOROUTEEUROSAOLVD1YAQY2AP H3S-00003 - MICROSOFTSCULPT COMFORT MOUSE WIN7/8 BLUETOOTH EN/XC/XX AMER 1 LICENSE BLACK
689-00986 - AUTOROUTEEUROSAOLVD1YAQY3AP 5LV-00001 - MICROSOFTSCULPT ERGONOMIC MOUSE FOR BUSINESS WIN7/8 EN/XC/XD/XX NORTH AMERICA 1
689-00987 - AUTOROUTEEUROSAOLVD2YAQY2AP GMF-00329 - MICROSOFTWIRELESS MOBILE MOUSE 3500 MAC/WIN USB PORT EN/XC/XX B 1 LICENSE PRICE
689-00988 - AUTOROUTEEUROSAOLVD3YAQY1AP EJF-02450 - MLPTSVRCAL 2012 OLP NL LCLGOV W USRCAL
689-01016 - AUTOROUTEEUROSNGLLICSAPKOLVC1YAQY1 74H-00048 - MS EXCH HOST FILTERING ALLLNG MNTHLYSUB OLVNL 1M ADDPRD PER D
689-01020 - AUTOROUTEEUROSNGLLICSAPKOLVC1YAQY2 74H-00048 - MS EXCH HOST FILTERING ALLLNG MNTHLYSUB OLVNL 1M ADDPRD PER D
689-01024 - AUTOROUTEEUROSNGLLICSAPKOLVC1YAQY3 74H-00018 - MS EXCH HOST FILTERING ALLLNG MNTHLYSUB OLVNL 1M ADDPRD PER U
689-01029 - AUTOROUTEEUROSNGLLICSAPKOLVC2YAQY2 74H-00018 - MS EXCH HOST FILTERING ALLLNG MNTHLYSUB OLVNL 1M ADDPRD PER U
689-01033 - AUTOROUTEEUROSNGLLICSAPKOLVC3YAQY1 74H-00100 - MS EXCH HOSTED FILTERING ENGLISH MNTHLYSUBSCRIPTION OLV NL 1M PROMO USER
689-01017 - AUTOROUTEEUROSNGLSAOLVC1YAQY1AP 74H-00049 - MS EXCH HOSTED FILTERING ENGLISH MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD PER D
689-01021 - AUTOROUTEEUROSNGLSAOLVC1YAQY2AP 74H-00049 - MS EXCH HOSTED FILTERING ENGLISH MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD PER D
689-01025 - AUTOROUTEEUROSNGLSAOLVC1YAQY3AP 74P-00008 - MS EXCHANGE HOSTD ARCHIVE ENGLISH MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD PER
689-01030 - AUTOROUTEEUROSNGLSAOLVC2YAQY2AP 74H-00030 - MS EXCHNGE HST FILTERING OLVNL ADD US
689-01034 - AUTOROUTEEUROSNGLSAOLVC3YAQY1AP 74H-00023 - MS EXCHNGE HSTD FILTERING ENGLISH MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD PER
U4X-00001 - AZUREIDENTITY SHRDSVR SUBSVL MVL MFAAUTH 74H-00023 - MS EXCHNGE HSTD FILTERING ENGLISH MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD PER
U4X-00003 - AZUREIDENTITY SHRDSVR SUBSVL MVMFAUSERS S27-00033 - MS InfoPath - License & software assurance - 1 user - VOL, GOV - MOLP
CP3-00003 - AZURERGHTSMGMTOPEN NL ANNUAL QLFD S27-00038 - MS InfoPath - Software assurance - 1 user - VOL, GOV - MOLP
CP3-00007 - AZURERGHTSMGMTOPEN ENG LCLGOV QLFD B21-00304 - MS MapPoint - license & software assurance
CP3-00005 - AZURERGHTSMGMTSRVCSOPEN OLV D 1MTH AP B21-00314 - MS MapPoint - License & software assurance - 1 user - VOL - MOLP - level C
CP3-00004 - AZURERGHTSMGMTSRVCSOPEN OLV D 1MTH AP B21-00321 - MS MapPoint - License & software assurance - 1 user - VOL - Open Business
CP3-00002 - AZURERGHTSMGMTSRVCSOPEN OLV NL 1MTH AP B21-00359 - MS MapPoint - Software assurance - 1 user - VOL - Open Business
CP3-00001 - AZURERGHTSMGMTSRVCSOPEN OLV NL 1MTH AP G71-03019 - MS MSDN Operating Systems - License & software assurance - 1 user - VOL - Open V
5S2-00003 - AZURESUBSSRVCESOPN NL G71-03018 - MS MSDN Operating Systems - Software assurance - 1 user - VOL - Open Volume - le
5S2-00007 - AZURESUBSSRVCESOPN ENG NL LCLGOV 269-06240 - MS Office Professional Edition - License - 1 user - EDU, VOL - Campus
5S2-00004 - AZURESUBSSRVCESOPN SHRDSVR ALNG SUBSVL OLV D 1MTH AP B17-00155 - MS Streets & Trips - software assurance
5S2-00001 - AZURESUBSSRVCESOPN SHRDSVR ALNG SUBSVL OLV NL 1MTH AP 070-02440 - MS Works ( v. 8.0 ) - complete package - 1 user - STD - CD - Win
T6V-00029 - BGMPSITRNLWSTSBSVL OLV D 1MTH 250KTRSCTS G71-03025 - MSDN For Windows Operating Systems REV 1 Software Assurance 32-Bit Win License O
U2V-00002 - BIGMAPSETPLATSUBSVL OLVNL 1MTH SRVCS G71-03024 - MSDN For Windows Operating Systems REV 2 Software Assurance 32-Bit Win License O
T6V-00009 - BIGMAPSITRNLWBST SBSVLOLV D MTH G71-03026 - MSDN For Windows Operating Systems REV 2 Software Assurance 32-Bit Win License O
T5V-00004 - BIGMAPSLGHTKNUSRSBSVL OLV1MTH5KBDL 1USR G71-03027 - MSDN For Windows Operating Systems REV 3 Software Assurance 32-Bit Win License O
T7V-00018 - BIGMAPSMBTMGMTSBSVL OLV C 1MTH EUWRTNG G71-03824 - MSDN OS ALL LNG LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
T7V-00017 - BIGMAPSMBTMGMTSBSVL OLV C 1MTH EUWRTNG G71-03828 - MSDN OS ALL LNG LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
T7V-00034 - BIGMAPSMBTMGMTSBSVL OLV C 1MTH NAWRTNG G71-03832 - MSDN OS ALL LNG LIC/SA PK OLV NL 1YR ADD
T7V-00033 - BIGMAPSMBTMGMTSBSVL OLV C 1MTH NAWRTNG G71-03819 - MSDN OS ALL LNG SA OLV NL 1YR ACQ Y1 ADDTL PROD
T7V-00009 - BIGMAPSMBTMGMTSBSVL OLV C1MTHAPASSTADDON G71-03823 - MSDN OS ALL LNG SA OLV NL 3YR ACQ Y1 ADDTL PROD
T7V-00020 - BIGMAPSMBTMGMTSBSVL OLV D 1MTH EUWRTNG G71-04174 - MSDNOS ALNG LICSAPK OLV C 1Y AP
T7V-00036 - BIGMAPSMBTMGMTSBSVL OLV D 1MTH NAWRTNG G71-04117 - MSDNOS ALNG LICSAPK OLV D 1Y AP
T7V-00013 - BIGMAPSMBTMGMTSBSVL OLV D 1MTHAPADDON G71-03825 - MSDNOSALLLNGLIC/SAPACKOLVNL1YRACQY2ADDTL
T7V-00024 - BIGMAPSMBTMGMTSBSVL OLV NL 1MTH EUWRTNG G71-03826 - MSDNOSALLLNGLIC/SAPACKOLVNL1YRACQY3ADDTL
T7V-00019 - BIGMAPSMBTMGMTSBSVL OLV NL 1MTH EUWRTNG G71-03827 - MSDNOSALLLNGLIC/SAPACKOLVNL2YRACQY2ADDTL
T7V-00035 - BIGMAPSMBTMGMTSBSVL OLV NL 1MTH NAWRTNG G71-03820 - MSDNOSALLLNGSAOLVNL1YRACQY2ADDTLPRODQUAL
T7V-00040 - BIGMAPSMBTMGMTSBSVL OLV NL 1MTH NAWRTNG G71-03821 - MSDNOSALLLNGSAOLVNL1YRACQY3ADDTLPRODQUAL
T7V-00012 - BIGMAPSMBTMGMTSBSVL OLVNL 1MTHAPASTADDON G71-03822 - MSDNOSALLLNGSAOLVNL2YRACQY2ADDTLPRODQUAL
T7V-00010 - BIGMAPSMBTMGTSBSVL OLVNL 1MTHAPASSTADDON G71-04168 - MSDNOSALNGLICSAPKOLVC1YAQY1AP
T7V-00044 - BIGMAPSMBTMSBSVL OLVNL 1MTH PLTFRMSRVCS G71-04170 - MSDNOSALNGLICSAPKOLVC1YAQY2AP
T7V-00043 - BIGMAPSMBTMTSBSVL OLVC 1MTH PLTFRM SRVCS G71-04172 - MSDNOSALNGLICSAPKOLVC1YAQY3AP
T7V-00045 - BIGMAPSMBTMTSBSVL OLVD 1MTH PLTFRM SRVCS G71-04175 - MSDNOSALNGLICSAPKOLVC2YAQY2AP
T7V-00011 - BIGMAPSMBTSBSVL OLVC 1MTHAP PERASSTADDON G71-04177 - MSDNOSALNGLICSAPKOLVC3YAQY1AP
T6V-00008 - BIGMAPSTRNLWBST SBSVLOLVD1MTH 250KTRSCTS G71-04169 - MSDNOSALNGSAOLVC1YAQY1AP
T9V-00026 - BIGMAPSWBST SBSVL OLV D 1MTH UNLTDTRSCTS G71-04171 - MSDNOSALNGSAOLVC1YAQY2AP
T6V-00007 - BIGMPSILWBST SSVL OLV D 1MTH 100KTRSCTNS G71-04173 - MSDNOSALNGSAOLVC1YAQY3AP
T6V-00027 - BIGMPSITLWSTSSVL OLVNL1MTH UNLTDTRSCTS G71-04176 - MSDNOSALNGSAOLVC2YAQY2AP
T6V-00025 - BIGMPSITRLWSTSBSVL OLVNL 1MTH 250KTRSCTS G71-04178 - MSDNOSALNGSAOLVC3YAQY1AP
T6V-00028 - BIGMPSITRLWTSBSVL OLVD 1MTH 100KTRSCTS G71-04113 - MSDNOSLICSAPKOLVD1YAQY2AP
T6V-00003 - BIGMPSITRNLWSTSBSVL OLV C 1MTH 250KTRCTS G71-04114 - MSDNOSLICSAPKOLVD1YAQY3AP
T6V-00022 - BIGMPSITRNLWSTSBSVL OLVC 1MTH 100KTRSCTS G71-04115 - MSDNOSLICSAPKOLVD2YAQY2AP
T6V-00001 - BIGMPSITRNLWSTSBSVL OLVC1MTH100KTRNSCTNS G71-04116 - MSDNOSLICSAPKOLVD3YAQY1AP
T6V-00004 - BIGMPSITRNLWSTSBSVL OLVNL 1MTH 250KTRSTS G71-04107 - MSDNOSSAOLVD1YAQY1AP
T6V-00023 - BIGMPSITRNLWSTSBSVL OLVNL1MTH 100KTRSCTS G71-04108 - MSDNOSSAOLVD1YAQY2AP
T6V-00006 - BIGMPSITRNLWSTSBSVLOLVNL1MTH ULMTDTRSCNS G71-04109 - MSDNOSSAOLVD1YAQY3AP
T6V-00024 - BIGMPSITRNLWSTSSVL OLV C 1MTH 250KTRSCTS G71-04110 - MSDNOSSAOLVD2YAQY2AP
T6V-00005 - BIGMPSITRNLWSTVL OLV C 1MTH ULMTDTRNSCTS G71-04111 - MSDNOSSAOLVD3YAQY1AP
T6V-00026 - BIGMPSITRNLWSTVL OLV C 1MTH UNLTDTRSCTS 3VU-00015 - MSDNPLTFRMS ALNG LICSAPK OLV C 1Y AP
T6V-00002 - BIGMPSITRNLWSTVL OLVNL1MTH 100KTRNSCTNS 3VU-00023 - MSDNPLTFRMS ALNG LICSAPK OLV D 1Y AP
T3V-00014 - BIGMPSKNWNUSR SBSVL OLVD 1MTH 5KBDL 1USR 3VU-00016 - MSDNPLTFRMS ALNG LICSAPK OLV NL 1Y AP
T5V-00003 - BIGMPSLGHTKNUSRSBSVL OLVC1MTH 5KBDL 1USR 3VU-00005 - MSDNPLTFRMS ALNG SA OLV C 1Y AQY1 AP
T5V-00006 - BIGMPSLGHTKWNSR SBSVLOLVD1MTH 5KBDL 1USR 3VU-00009 - MSDNPLTFRMS ALNG SA OLV C 1Y AQY2 AP
T6V-00030 - BIGMPSLWSTSBSVL OLV D 1MTH UNLTDTRSCTNS 3VU-00013 - MSDNPLTFRMS ALNG SA OLV C 1Y AQY3 AP
T7V-00041 - BIGMPSMBMGTSBSVL OLV C 1MTH PLTFRM SRVCS 3VU-00026 - MSDNPLTFRMS ALNG SA OLV C 2Y AQY2 AP
T7V-00042 - BIGMPSMBTMGMTSBSVL OLV 1MTH PLTFRMSRVCS 3VU-00032 - MSDNPLTFRMS ALNG SA OLV C 3Y AQY1 AP
T9V-00019 - BIGMPSPBLICBSSBSVL OLVNL 1MTH 250KTRSCTS 3VU-00006 - MSDNPLTFRMS ALNG SA OLV NL 1Y AQY1 AP
T9V-00020 - BIGMPSPBLICSTSBSVL OLVNL 1MTH 250KTRSCTS 3VU-00010 - MSDNPLTFRMS ALNG SA OLV NL 1Y AQY2 AP
T9V-00021 - BIGMPSPBLICWBL OLV C 1MTH UNLMTDTRNSCTNS 3VU-00014 - MSDNPLTFRMS ALNG SA OLV NL 1Y AQY3 AP
T9V-00003 - BIGMPSPBLICWBSTSBSVL OLV C1MT 100KTRSCTS 3VU-00027 - MSDNPLTFRMS ALNG SA OLV NL 2Y AQY2 AP
T9V-00025 - BIGMPSPBLICWBSTSBSVL OLV D 1MTH 3VU-00033 - MSDNPLTFRMS ALNG SA OLV NL 3Y AQY1 AP
T9V-00022 - BIGMPSPBLICWBSTSBSVL OLVNL 1MTH 3VU-00003 - MSDNPLTFRMS LICSAPK OLV C 1Y AQY1 AP
T9V-00018 - BIGMPSPBLICWBSTSVL OLV C 1MTH 250KTRSCTS 3VU-00007 - MSDNPLTFRMS LICSAPK OLV C 1Y AQY2 AP
T9V-00005 - BIGMPSPBLICWBSVL OLV D 1MTH 100KTRNSCTNS 3VU-00011 - MSDNPLTFRMS LICSAPK OLV C 1Y AQY3 AP
T9V-00001 - BIGMPSWBSTSBSVL OLV C 1MTH 100KTRNSCTNS 3VU-00024 - MSDNPLTFRMS LICSAPK OLV C 2Y AQY2 AP
T9V-00009 - BIGMPSWBSTSBSVL OLV C 1MTH 250KTRSCTS 3VU-00030 - MSDNPLTFRMS LICSAPK OLV C 3Y AQY1 AP
T9V-00023 - BIGMPSWBSTSBSVL OLV C 1MTH UNLMTDTRNSCTS 3VU-00017 - MSDNPLTFRMS LICSAPK OLV D 1Y AQY1 AP
T9V-00002 - BIGMPSWBSTSBSVL OLVNL 1MTH 100KTRNSCTNS 3VU-00019 - MSDNPLTFRMS LICSAPK OLV D 1Y AQY2 AP
T9V-00010 - BIGMPSWBSTSBSVL OLVNL 1MTH 250KTRSCTS 3VU-00021 - MSDNPLTFRMS LICSAPK OLV D 1Y AQY3 AP
SFA-00070 - BING MAPS ADD ON SNGL MONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE 1 LICENSE N 3VU-00028 - MSDNPLTFRMS LICSAPK OLV D 2Y AQY2 AP
SFA-00070 - BING MAPS ADD ON SNGL MONTHLY SUBSCRIPTIONS-VOLUMELICENSE OPEN VALUE 1 LICENSE N 3VU-00034 - MSDNPLTFRMS LICSAPK OLV D 3Y AQY1 AP
SFA-00060 - BING ONMONTHLY OV1LICLV250K TRAN1MONT 3VU-00001 - MSDNPLTFRMS LICSAPK OLV E 1Y ACDMC AP
SFA-00060 - BING ONMONTHLY OV1LICLV250K TRAN1MONT 3VU-00002 - MSDNPLTFRMS LICSAPK OLV F 1Y ACDMC AP
SFA-00068 - BING ONMONTHLY OV1LICLV25K TRAN1MON 3VU-00004 - MSDNPLTFRMS LICSAPK OLV NL 1Y AQY1 AP
SFA-00068 - BING ONMONTHLY OV1LICLV25K TRAN1MON 3VU-00008 - MSDNPLTFRMS LICSAPK OLV NL 1Y AQY2 AP
SFA-00059 - BING ONMONTHLY OV1LICLVC 250K TRAN1MON 3VU-00012 - MSDNPLTFRMS LICSAPK OLV NL 1Y AQY3 AP
SFA-00059 - BING ONMONTHLY OV1LICLVC 250K TRAN1MON 3VU-00025 - MSDNPLTFRMS LICSAPK OLV NL 2Y AQY2 AP
SFA-00067 - BING ONMONTHLY OV1LICLVC 25K TRAN1MON 3VU-00031 - MSDNPLTFRMS LICSAPK OLV NL 3Y AQY1 AP
SFA-00067 - BING ONMONTHLY OV1LICLVC 25K TRAN1MON 3VU-00018 - MSDNPLTFRMS SA OLV D 1Y AQY1 AP
SFA-00063 - BING ONMONTHLY OV1LICLVD 250K TRAN1MON 3VU-00020 - MSDNPLTFRMS SA OLV D 1Y AQY2 AP
SFA-00063 - BING ONMONTHLY OV1LICLVD 250K TRAN1MON 3VU-00022 - MSDNPLTFRMS SA OLV D 1Y AQY3 AP
SFA-00071 - BING ONMONTHLY OV1LICLVD 25K TRAN1MON 3VU-00029 - MSDNPLTFRMS SA OLV D 2Y AQY2 AP
SFA-00071 - BING ONMONTHLY OV1LICLVD 25K TRAN1MON 3VU-00035 - MSDNPLTFRMS SA OLV D 3Y AQY1 AP
SFA-00091 - BINGMAPS SBSVL OLV C 1MTH AP 250KTRNSCTN T2Z-00062 - NL 1Y AQY1 VSDPLYMNTSTD AP 2PROC
SFA-00091 - BINGMAPS SBSVL OLV C 1MTH AP 250KTRNSCTN T2Z-00122 - NL 1Y AQY2 VSDPLYMNTSTD AP 2PROC
SFA-00093 - BINGMAPS SUBSVL OLV C 1MTH AP 25KTRNSCTN T2Z-00027 - NL 1Y AQY3 VSDPLYMNTSTD AP 2PROC
SFA-00093 - BINGMAPS SUBSVL OLV C 1MTH AP 25KTRNSCTN T2Z-00149 - NL 2Y AQY2 VSDPLYMNTSTD AP 2PROC
SFA-00092 - BINGMAPS SUBSVL OLV NL 1MTH AP 250KTSCTN NW2-00001 - NW2-00001-12
SFA-00092 - BINGMAPS SUBSVL OLV NL 1MTH AP 250KTSCTN NX2-00001 - NX2-00001-12
SFA-00094 - BINGMAPS SUBSVL OLV NL 1MTH AP 25KTNSCTN NY2-00001 - NY2-00001-12
SFA-00094 - BINGMAPS SUBSVL OLV NL 1MTH AP 25KTNSCTN Q7Y-00005 - O365PROPLUSOP SHRDSVR SBSVL OLV D1MTH AP
SFA-00051 - BINGMAPSADDON 1MTHULTDTRXADDON ADDON Q7Y-00001-12 - O365PROPLUSOP SUBSVL OLV NL 1MTH AP
SFA-00052 - BINGMAPSADDON 1MTHULTDTRXADDON ADDON Q7Y-00011 - O365PROPLUSOPEN 1MTH AP RNW2CLOUDPROMO
SFA-00052 - BINGMAPSADDON 1MTHULTDTRXADDON ADDON Q7Y-00009 - O365PROPLUSOPEN 1MTH AP RNW2CLOUDPROMO
SFA-00051 - BINGMAPSADDON 1MTHULTDTRXADDON ADDON Q7Y-00010-12 - O365PROPLUSOPEN AP RNW2CLOUDPROMO
SFA-00009 - BINGMAPSADDON ALNG SUBSVL 1MTH APPERUSR Q7Y-00008-12 - O365PROPLUSOPEN AP RNW2CLOUDPROMO
SFA-00009 - BINGMAPSADDON ALNG SUBSVL 1MTH APPERUSR Q7Y-00003 - O365PROPLUSOPEN OLP NL ANNUAL QLFD
SFA-00055 - BINGMAPSADDON OLV1MTHULTDTRXADDON ADDON Q7Y-00002 - O365PROPLUSOPEN OLV NL 1MTH AP
SFA-00055 - BINGMAPSADDON OLV1MTHULTDTRXADDON ADDON Q7Y-00021-12 - O365PROPLUSOPENALNG D 1MTH EACH PLTFRM
LQD-00001 - BINGMAPSDSKTPWECP ALNG SUBSVL 1MTH AP Q7Y-00017-12 - O365PROPLUSOPENALNG NL 1MTH EACH PLTFRM
LQD-00001 - BINGMAPSDSKTPWECP ALNG SUBSVL 1MTH AP Q7Y-00019-12 - O365PROPLUSOPENALNG OLV D 1MTH EACH ENT
LQD-00002 - BINGMAPSDSKTPWECP ALNG SUBSVL 1MTH AP Q7Y-00020 - O365PROPLUSOPENALNG OLV D 1MTH ENT
LQD-00002 - BINGMAPSDSKTPWECP ALNG SUBSVL 1MTH AP Q7Y-00022 - O365PROPLUSOPENALNG OLV D 1MTH PLTFRM
LQD-00001 - BINGMAPSDSKTPWECP ALNG SUBSVL OLV C 1MTH AP Q7Y-00015-12 - O365PROPLUSOPENALNG OLV NL 1MTH EACH ENT
LQD-00005 - BINGMAPSDSKTPWECP ALNG SUBSVL OLV D 1MTH AP Q7Y-00016 - O365PROPLUSOPENALNG OLV NL 1MTH ENT
LQD-00002 - BINGMAPSDSKTPWECP ALNG SUBSVL OLV NL 1MTH AP Q7Y-00018 - O365PROPLUSOPENALNG OLV NL 1MTH PLTFRM
LQD-00005 - BINGMAPSDSKTPWECP SUBSVL OLV D 1MTH Q7Y-00007 - O365PROPLUSOPSUBSVL OLP NLLCLGOV QLFD
LQD-00005 - BINGMAPSDSKTPWECP SUBSVL OLV D 1MTH Q7Y-00004-12 - O365PROPLUSOPSUBSVL OLV D 1MTH AP
U2V-00006 - BINGMAPSENTPLATFORM SBSVL OLVD1MTH SRVCS R18-03665 - OEM WINSRV 2012 1CLT DEVICE CAL ENG
U2V-00001 - BINGMAPSETPLATFORMSBSVL OLV C 1MTH SRVCS R18-03737 - OEM WINSRV 2012 1CLT USER CAL ENG
U2V-00003 - BINGMAPSETPLATFORMSBSVL OLV C 1MTH SRVCS W6F-00198 - OFF MAC HME BSSS 1PK 2011 EGLSH NA MDLSS
U2V-00005 - BINGMAPSETPLATFORMSBSVL OLV D 1MTH SRVCS 9F5-00003 - OFF365BUSESSNTLOPN SHRDSVR
T6V-00042 - BINGMAPSINTRNLWBST DAP USAGE1.25M ADDON 9F5-00002-12 - OFF365BUSESSNTLOPN SHRDSVR NL 1MTH AP
T6V-00048 - BINGMAPSINTRNLWBST DAP USAGE2.1M ADDON J29-00003 - OFF365BUSINESSOPN SHRDSVR
T6V-00036 - BINGMAPSINTRNLWBST DAP USAGE420 ADDON J29-00002-12 - OFF365BUSINESSOPN SHRDSVR NL 1MTH AP
T6V-00037 - BINGMAPSINTRNLWBSTCAP USAGE1.25M ADDON 9F4-00003 - OFF365BUSPREMOPN SHRDSVR
T6V-00039 - BINGMAPSINTRNLWBSTCAP USAGE1.25M ADDON 9F4-00002-12 - OFF365BUSPREMOPN SHRDSVR NL 1MTH AP
T6V-00045 - BINGMAPSINTRNLWBSTCAP USAGE2.1M ADDON 5GV-00002 - OFF365MDSZ SHRDSVR SNGL OLV NL 1MTH AP
T6V-00043 - BINGMAPSINTRNLWBSTCAP USAGE2.1M ADDON 5GV-00001-12 - OFF365MDSZ SHRDSVVL OLV NL 1MTH AP
T6V-00031 - BINGMAPSINTRNLWBSTCAP USAGE420 ADDON 5GV-00010 - OFF365MDSZBSNSSOPEN 1M AP PLTFRM ADDON
T6V-00033 - BINGMAPSINTRNLWBSTCAP USAGE420K ADDON 5GV-00009 - OFF365MDSZBSNSSOPEN NL 1M AP PLTFRMOPP
T6V-00041 - BINGMAPSINTRNLWBSTDAP USAGE1.25M ADDON 5GV-00005 - OFF365MDSZBSNSSOPEN 1M AP ENT CORECAL
T6V-00047 - BINGMAPSINTRNLWBSTDAP USAGE2.1M ADDON 5GV-00004-12 - OFF365MDSZBSNSSOPEN 1M AP ENTCORECAL
T6V-00035 - BINGMAPSINTRNLWBSTDAP USAGE420K ADDON 5GV-00008 - OFF365MDSZBSNSSOPEN 1M AP PLTFRMADDON
T6V-00038 - BINGMAPSINTRNLWBSTNLAP USAGE1.25M ADDON 5GV-00007 - OFF365MDSZBSNSSOPEN 1MTH AP ENT OPP
T6V-00040 - BINGMAPSINTRNLWBSTNLAP USAGE1.25M ADDON 5GV-00011-12 - OFF365MDSZBSNSSOPEN AP PLTFRM CORECAL
T6V-00044 - BINGMAPSINTRNLWBSTNLAP USAGE2.1M ADDON 5GV-00006-12 - OFF365MDSZBSNSSOPEN NL 1MTH AP ENTOPP
T6V-00046 - BINGMAPSINTRNLWBSTNLAP USAGE2.1M ADDON M7K-00001 - OFF365PA3 SHRDSVR ALNG SUBSVL MVL PERUSR
T6V-00032 - BINGMAPSINTRNLWBSTNLAP USAGE420 ADDON 7JT-00004 - OFF365PLANE1ARCHSBSVL OLPNLL LCLGOV QLFD
T6V-00034 - BINGMAPSINTRNLWBSTNLAP USAGE420K ADDON 7JT-00005-12 - OFF365PLANE1ARCHVNG 1MTH AP PLTFRM
T3V-00006 - BINGMAPSKNWNUSR SUBSVL OLV D 1MTH PERUSR 7JT-00006 - OFF365PLANE1ARCHVNG D 1MTH AP PLTFRM
T3V-00003 - BINGMAPSKNWNUSRSUBSVL OLV C 1MTH PERUSR Q4Y-00015 - OFF365PLANE1OPEN D 1M AP PLTFRMCORECAL
T3V-00001 - BINGMAPSKNWNUSRSUBSVL OLV C 1MTH PERUSR Q4Y-00012 - OFF365PLANE1OPEN 1M AP PLTFRM CORECAL
T3V-00005 - BINGMAPSKNWNUSRSUBSVL OLV D 1MTH PERUSR Q4Y-00014 - OFF365PLANE1OPEN NL 1M AP PLTFRMCORECAL
T3V-00002 - BINGMAPSKNWNUSRSUBSVL OLV NL 1MTH PERUSR Q5Y-00023 - OFF365PLANE3OPEN 1M AP PLTFRMCALSTEW/OPP
T3V-00012 - BINGMAPSKNWUSRSBSVL OLVNL 1MTH5KBDL 1USR Q4Z-00007 - OFF365PLANE4OPEN LCLGOV QLFD
T3V-00011 - BINGMAPSKWNUSRSVL OLV C 1MTH 5KBNDL 1USR Q4Z-00004-12 - OFF365PLANE4OPEN OLV D 1MTH AP
T5V-00011 - BINGMAPSLGHTKWNUSRSBSVL OLV C 1MTH 1USR Q4Z-00001-12 - OFF365PLANE4OPEN OLV NL 1MTH AP
T5V-00009 - BINGMAPSLGHTKWNUSRSBSVL OLV C 1MTH 1USR Q4Z-00003 - OFF365PLANE4OPEN QLFD
T5V-00013 - BINGMAPSLGHTKWNUSRSBSVL OLV D 1MTH 1USR Q4Z-00005 - OFF365PLANE4OPEN SHRDSVRSUBSVL D 1MTH AP
T5V-00010 - BINGMAPSLGHTKWNUSRSBSVL OLVNL 1MTH 1USR Q4Z-00002 - OFF365PLANE4OPEN SUBSVL NL 1MTH AP
T5V-00005 - BINGMAPSLGHTSRSBSVL OLV D 1MTH 5KBNDL Q4Z-00014-12 - OFF365PLANE4OPENALNG D 1MTH EACH PLTFRM
T5V-00002 - BINGMAPSLGHTUSRVL OLVNL 1MTH 5KBDL 1USR Q4Z-00012-12 - OFF365PLANE4OPENALNG OLV D 1MTH EACH ENT
T5V-00001 - BINGMAPSLGHTVL OLV C 1MTH 5KBNDL 1USR Q4Z-00013 - OFF365PLANE4OPENALNG OLV D 1MTH ENT
T5V-00012 - BINGMAPSLIGHTKNUSRSBSVL OLVNL 1MTH 1USR Q4Z-00015 - OFF365PLANE4OPENALNG OLV D 1MTH PLTFRM
T5V-00014 - BINGMAPSLIGHTKWNUSR SBSVLOLVD1MTH 1USR Q4Z-00008-12 - OFF365PLANE4OPENALNG OLV NL 1MTH EACHENT
T7V-00021 - BINGMAPSMBLASST SBSVL OLV D 1MTH EUWRTNG Q4Z-00009 - OFF365PLANE4OPENALNG OLV NL 1MTH ENT
T7V-00014 - BINGMAPSMBLASSTMNGMNT SBSVL OLV D 1MTH Q4Z-00011 - OFF365PLANE4OPENALNG OLV NL 1MTH PLTFRM
T7V-00037 - BINGMAPSMBLASSTMNGMNT SBSVLOLV DNAWRTNG Q4Z-00010-12 - OFF365PLANE4OPENALNGNL 1MTH EACH PLTFRM
T7V-00046 - BINGMAPSMBLASSTMNT SBSVL OLV D 1MTHSRVCS Q5Y-00017 - OFF365PLNE3OPEN 1M AP ENT CALSTEW/OPP
SGA-00009 - BINGMAPSPRO ALNG SUBSVL 1MTH AP SRVCS Q5Y-00016-12 - OFF365PLNE3OPEN 1M AP ENTCALSTEW/OPP
SGA-00009 - BINGMAPSPRO ALNG SUBSVL 1MTH AP SRVCS Q5Y-00021 - OFF365PLNE3OPEN 1MAP CALSTEW/OPP
T9V-00064 - BINGMAPSPUBLICWBST DAP USAGE2.5M ADDON Q5Y-00020-12 - OFF365PLNE3OPEN AP PLTFRM CALSTEW/OPP
T9V-00052 - BINGMAPSPUBLICWBST DAP USAGE4.2M ADDON Q5Y-00018-12 - OFF365PLNE3OPEN D 1M AP ENTCALSTEW/OPP
T9V-00046 - BINGMAPSPUBLICWBST DAP USAGE420 ADDON Q5Y-00022-12 - OFF365PLNE3OPEN PLTFRM CALSTEW/OPP
T9V-00040 - BINGMAPSPUBLICWBST DAP USAGE8.4M ADDON 9ST-00143 - OFFADTANDCNTRLMNGMNT 2013 SNGL OLP C
T9V-00058 - BINGMAPSPUBLICWBST DAP USAGE840 ADDON 9ST-00144 - OFFADTANDCNTRLMNGMNT 2013 SNGL OLP NL
T9V-00061 - BINGMAPSPUBLICWBSTCAP USAGE2.5M ADDON 9ST-00091 - OFFADTANDCNTRLMNGMNT ALNG LICSAPK MVL
T9V-00059 - BINGMAPSPUBLICWBSTCAP USAGE2.5M ADDON 9ST-00101 - OFFADTANDCNTRLMNGMNT LICSAPK OLV C 1Y AP
T9V-00047 - BINGMAPSPUBLICWBSTCAP USAGE4.2M ADDON 9ST-00104 - OFFADTANDCNTRLMNGMNT SA OLV D 1Y AQY1 AP
T9V-00049 - BINGMAPSPUBLICWBSTCAP USAGE4.2M ADDON 9ST-00106 - OFFADTANDCNTRLMNGMNT SA OLV D 1Y AQY2 AP
T9V-00041 - BINGMAPSPUBLICWBSTCAP USAGE420 ADDON 9ST-00109 - OFFADTANDCNTRLMNGMNT SA OLV D 1Y AQY3 AP
T9V-00043 - BINGMAPSPUBLICWBSTCAP USAGE420K ADDON 9ST-00117 - OFFADTANDCNTRLMNGMNT SA OLV D 2Y AQY2 AP
T9V-00037 - BINGMAPSPUBLICWBSTCAP USAGE8.4M ADDON 9ST-00123 - OFFADTANDCNTRLMNGMNT SA OLV D 3Y AQY1 AP
T9V-00035 - BINGMAPSPUBLICWBSTCAP USAGE8.4M ADDON 9ST-00139 - OFFADTANDCNTRLMNGMNT SNGL LICSAPK OLP C
T9V-00053 - BINGMAPSPUBLICWBSTCAP USAGE840 ADDON 9ST-00140 - OFFADTANDCNTRLMNGMNT SNGL LICSAPK OLP NL
T9V-00055 - BINGMAPSPUBLICWBSTCAP USAGE840K ADDON 9ST-00141 - OFFADTANDCNTRLMNGMNT SNGL SA OLP C
T9V-00063 - BINGMAPSPUBLICWBSTDAP USAGE2.5M ADDON 9ST-00142 - OFFADTANDCNTRLMNGMNT SNGL SA OLP NL
T9V-00051 - BINGMAPSPUBLICWBSTDAP USAGE4.2M ADDON 9ST-00110 - OFFADTANDCNTRLMNGMNTLICSAPK OLV D 1Y AP
T9V-00045 - BINGMAPSPUBLICWBSTDAP USAGE420K ADDON 9ST-00088 - OFFADTDCNTRLNGMNT 2013 OLP NL LCLGOV
T9V-00039 - BINGMAPSPUBLICWBSTDAP USAGE8.4M ADDON 9ST-00135 - OFFADTDCNTRLNGMNT 2013 SNGL OLP NL ACDMC
T9V-00057 - BINGMAPSPUBLICWBSTDAP USAGE840K ADDON 9ST-00138 - OFFADTDCNTRLNGMNT 2013 SNGL OLP NL CHRTY
T9V-00062 - BINGMAPSPUBLICWBSTNLAP USAGE2.5M ADDON 9ST-00162 - OFFADTDCNTRLNGMNT LICSAPK OLP NL LCLGOV
T9V-00060 - BINGMAPSPUBLICWBSTNLAP USAGE2.5M ADDON 9ST-00102 - OFFADTDCNTRLNGMNT LICSAPK OLV NL 1Y AP
T9V-00048 - BINGMAPSPUBLICWBSTNLAP USAGE4.2M ADDON 9ST-00087 - OFFADTDCNTRLNGMNT SA OLP NL LCLGOV
T9V-00050 - BINGMAPSPUBLICWBSTNLAP USAGE4.2M ADDON 9ST-00133 - OFFADTDCNTRLNGMNT SNGL SA OLP NL ACDMC
T9V-00042 - BINGMAPSPUBLICWBSTNLAP USAGE420 ADDON 9ST-00137 - OFFADTDCNTRLNGMNT SNGL SA OLP NL CHRTY
T9V-00044 - BINGMAPSPUBLICWBSTNLAP USAGE420K ADDON 9ST-00103 - OFFADTDCNTRLNGT LICSAPK OLV D 1Y AQY1 AP
T9V-00038 - BINGMAPSPUBLICWBSTNLAP USAGE8.4M ADDON 9ST-00105 - OFFADTDCNTRLNGT LICSAPK OLV D 1Y AQY2 AP
T9V-00036 - BINGMAPSPUBLICWBSTNLAP USAGE8.4M ADDON 9ST-00108 - OFFADTDCNTRLNGT LICSAPK OLV D 1Y AQY3 AP
T9V-00054 - BINGMAPSPUBLICWBSTNLAP USAGE840 ADDON 9ST-00116 - OFFADTDCNTRLNGT LICSAPK OLV D 2Y AQY2 AP
T9V-00056 - BINGMAPSPUBLICWBSTNLAP USAGE840K ADDON 9ST-00122 - OFFADTDCNTRLNGT LICSAPK OLV D 3Y AQY1 AP
T3V-00010 - BINGMAPSSBSVL OLVNL 1MTH 5KBNDL 1USR 9ST-00119 - OFFADTDCNTRLNGT LICSAPK OLV NL 3YAQY1 AP
LLD-00001 - BINGMAPSSVR ALNG SUBSVL OLV C 1MTH AP 9ST-00077 - OFFADTDCNTRLNGT LICSPK OLV E 1Y ACDMC AP
LLD-00001 - BINGMAPSSVR ALNG SUBSVL OLV C 1MTH AP 9ST-00078 - OFFADTDCNTRLNGT LICSPK OLV F 1Y ACDMC AP
LLD-00001 - BINGMAPSSVR ALNG SUBSVL OLV C 1MTH AP 9ST-00082 - OFFADTDCNTRLNGT SGL SA OLV NL 1Y AQY1 AP
LLD-00003 - BINGMAPSSVR ALNG SUBSVL OLV D 1MTH AP 9ST-00086 - OFFADTDCNTRLNGT SGL SA OLV NL 1Y AQY2 AP
LLD-00003 - BINGMAPSSVR ALNG SUBSVL OLV D 1MTH AP 9ST-00100 - OFFADTDCNTRLNGT SGL SA OLV NL 1Y AQY3 AP
LLD-00003 - BINGMAPSSVR ALNG SUBSVL OLV D 1MTH AP 9ST-00115 - OFFADTDCNTRLNGT SGL SA OLV NL 2Y AQY2 AP
LLD-00002 - BINGMAPSSVR ALNG SUBSVL OLV NL 1MTH AP 9ST-00081 - OFFADTDCNTRLNGT SNGL SA OLV C 1Y AQY1 AP
LLD-00002 - BINGMAPSSVR ALNG SUBSVL OLV NL 1MTH AP 9ST-00085 - OFFADTDCNTRLNGT SNGL SA OLV C 1Y AQY2 AP
LLD-00002 - BINGMAPSSVR ALNG SUBSVL OLV NL 1MTH AP 9ST-00099 - OFFADTDCNTRLNGT SNGL SA OLV C 1Y AQY3 AP
LMD-00002 - BINGMAPSSVRCAL ALNG SUBSVL 1MTH DVCCAL 9ST-00114 - OFFADTDCNTRLNGT SNGL SA OLV C 2Y AQY2 AP
LMD-00002 - BINGMAPSSVRCAL ALNG SUBSVL 1MTH DVCCAL 9ST-00120 - OFFADTDCNTRLNGT SNGL SA OLV C 3Y AQY1 AP
LMD-00001 - BINGMAPSSVRCAL ALNG SUBSVL 1MTH DVCCAL 9ST-00121 - OFFADTDCNTRLNGT SNGL SA OLV NL3Y AQY1 AP
LMD-00001 - BINGMAPSSVRCAL ALNG SUBSVL 1MTH DVCCAL 9ST-00131 - OFFADTDCNTRLNGT SNGL SAPK OLP NL ACDMC
LMD-00003 - BINGMAPSSVRCAL ALNG SUBSVL 1MTH USRCAL 9ST-00136 - OFFADTDCNTRLNGT SNGL SAPK OLP NL CHRTY
LMD-00004 - BINGMAPSSVRCAL ALNG SUBSVL 1MTH USRCAL 9ST-00079 - OFFADTDCNTRLNGTLICSAPK OLV C 1Y AQY1 AP
LMD-00004 - BINGMAPSSVRCAL ALNG SUBSVL 1MTH USRCAL 9ST-00083 - OFFADTDCNTRLNGTLICSAPK OLV C 1Y AQY2 AP
LMD-00003 - BINGMAPSSVRCAL ALNG SUBSVL 1MTH USRCAL 9ST-00097 - OFFADTDCNTRLNGTLICSAPK OLV C 1Y AQY3 AP
LMD-00001 - BINGMAPSSVRCAL ALNG SUBSVL OLV C 1MTH AP DVCCAL 9ST-00112 - OFFADTDCNTRLNGTLICSAPK OLV C 2Y AQY2 AP
LMD-00003 - BINGMAPSSVRCAL ALNG SUBSVL OLV C 1MTH AP USRCAL 9ST-00118 - OFFADTDCNTRLNGTLICSAPK OLV C 3Y AQY1 AP
LMD-00009 - BINGMAPSSVRCAL ALNG SUBSVL OLV D 1MTH AP DVCCAL 9ST-00080 - OFFADTDCNTRLNGTLICSAPK OLV NL 1Y AQY1 AP
LMD-00010 - BINGMAPSSVRCAL ALNG SUBSVL OLV D 1MTH AP USRCAL 9ST-00084 - OFFADTDCNTRLNGTLICSAPK OLV NL 1Y AQY2 AP
LMD-00002 - BINGMAPSSVRCAL ALNG SUBSVL OLV NL 1MTH AP DVCCAL 9ST-00098 - OFFADTDCNTRLNGTLICSAPK OLV NL 1Y AQY3 AP
LMD-00004 - BINGMAPSSVRCAL ALNG SUBSVL OLV NL 1MTH AP USRCAL 9ST-00113 - OFFADTDCNTRLNGTLICSAPK OLV NL 2Y AQY2 AP
LMD-00009 - BINGMAPSSVRCAL SUBSVL OLV D 1MTHDVCCAL D9U-00054 - OFFHOMEANDSTDNTRT 2013 ENG OLP NL LCLGOV
LMD-00009 - BINGMAPSSVRCAL SUBSVL OLV D 1MTHDVCCAL D9U-00032 - OFFHOMEANDSTDNTRT 2013 SNGL OLP C
LMD-00010 - BINGMAPSSVRCAL SUBSVL OLV D 1MTHUSRCAL D9U-00033 - OFFHOMEANDSTDNTRT 2013 SNGL OLP NL
LMD-00010 - BINGMAPSSVRCAL SUBSVL OLV D 1MTHUSRCAL AAA-04258 - OFFICE 365 HOME IS THE BEST OFFICE FOR YOU AND YOUR FAMILY. GET A 1-YEAR SUBSCRI
LND-00001 - BINGMAPSSVRWECP ALNG SUBSVL 1MTH AP QQ2-00021 - OFFICE 365 PERSONAL IS THE BEST OFFICE FOR YOU, AT HOME OR ON THE GO. GET A 1-YE
LND-00002 - BINGMAPSSVRWECP ALNG SUBSVL 1MTH AP QQ2-00011 - OFFICE 365 PERSONAL IS THE BEST OFFICE FOR YOU, AT HOME OR ON THE GO. GET A 1-YE
LND-00001 - BINGMAPSSVRWECP ALNG SUBSVL 1MTH AP 021-09106 - OFFICE ALL LNG LIC/SA PACK OLV NL 1YR AD
LND-00002 - BINGMAPSSVRWECP ALNG SUBSVL 1MTH AP B6I-00345 - OFFICE COMMUNICATOR ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
LND-00003 - BINGMAPSSVRWECP ALNG SUBSVL OLV 1MTH AP 021-07257 - OFFICE ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
LND-00003 - BINGMAPSSVRWECP ALNG SUBSVL OLV 1MTH AP 021-07258 - OFFICE ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD
LND-00001 - BINGMAPSSVRWECP ALNG SUBSVL OLV C 1MTH AP 021-07260 - OFFICE ENGLISH LIC/SA PACK OLV NL 2YR ACQ Y2 ADDTL PROD
LND-00003 - BINGMAPSSVRWECP ALNG SUBSVL OLV D 1MTH AP 021-07261 - OFFICE ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
LND-00002 - BINGMAPSSVRWECP ALNG SUBSVL OLV NL 1MTH AP 021-07262 - OFFICE ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
LPD-00001 - BINGMAPSSVRWECPCAL ALNG SUBSVL OLV C 1MTH AP DVCCAL 021-07264 - OFFICE ENGLISH SA OLV NL 1YR ACQ Y2 ADDTL PROD
LPD-00003 - BINGMAPSSVRWECPCAL ALNG SUBSVL OLV C 1MTH AP USRCAL 021-07266 - OFFICE ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
LPD-00009 - BINGMAPSSVRWECPCAL ALNG SUBSVL OLV D 1MTH AP DVCCAL W6F-00121 - OFFICE FOR MAC HOME AND BUSINESS IS DESIGNED AND LICENSED FOR MORE ADVANCED PERS
LPD-00010 - BINGMAPSSVRWECPCAL ALNG SUBSVL OLV D 1MTH AP USRCAL 269-05780 - Office For Windows Professional Edition Software Assurance 32-Bit Win License On
LPD-00002 - BINGMAPSSVRWECPCAL ALNG SUBSVL OLV NL 1MTH AP DVCCAL 269-05823 - Office For Windows Professional Edition Software Assurance 32-Bit Win License On
LPD-00004 - BINGMAPSSVRWECPCAL ALNG SUBSVL OLV NL 1MTH AP USRCAL 269-05828 - Office For Windows Professional Edition Software Assurance 32-Bit Win License On
LPD-00001 - BINGMAPSSVRWECPCAL SUBSVL 1MTHDVCCAL 269-05499 - Office For Windows Professional Edition Software Assurance 32-Bit Win License On
LPD-00001 - BINGMAPSSVRWECPCAL SUBSVL 1MTHDVCCAL 269-05577 - Office For Windows Professional Edition Software Assurance 32-Bit Win License On
LPD-00002 - BINGMAPSSVRWECPCAL SUBSVL 1MTHDVCCAL 269-05583 - Office For Windows Professional Edition Software Assurance 32-Bit Win License On
LPD-00002 - BINGMAPSSVRWECPCAL SUBSVL 1MTHDVCCAL 021-05429 - Office For Windows Standard Edition Software Assurance 32-Bit Win License Only N
LPD-00004 - BINGMAPSSVRWECPCAL SUBSVL 1MTHUSRCAL 021-05624 - Office For Windows Standard Edition Software Assurance 32-Bit Win License Only N
LPD-00003 - BINGMAPSSVRWECPCAL SUBSVL 1MTHUSRCAL 021-05641 - Office For Windows Standard Edition Software Assurance 32-Bit Win License Only N
LPD-00004 - BINGMAPSSVRWECPCAL SUBSVL 1MTHUSRCAL 021-05642 - Office For Windows Standard Edition Software Assurance 32-Bit Win License Only N
LPD-00003 - BINGMAPSSVRWECPCAL SUBSVL 1MTHUSRCAL 021-05426 - Office For Windows Standard Edition Software Assurance 32-Bit Win License Only N
LPD-00009 - BINGMAPSSVRWECPCAL SUBSVL D 1MTHDVCCAL 021-05427 - Office For Windows Standard Edition Software Assurance 32-Bit Win License Only N
LPD-00009 - BINGMAPSSVRWECPCAL SUBSVL D 1MTHDVCCAL 79U-01170 - OFFICE GROOVE ENT SERVICE ENGLISH MONTHLY SUBSCR OLV NL 1M ADDTL PROD PER
LPD-00010 - BINGMAPSSVRWECPCAL SUBSVL D 1MTHUSRCAL 79U-01170 - OFFICE GROOVE ENT SERVICE ENGLISH MONTHLY SUBSCR OLV NL 1M ADDTL PROD PER
LPD-00010 - BINGMAPSSVRWECPCAL SUBSVL D 1MTHUSRCAL 79U-01108 - OFFICE GROOVE ENT SERVICE SNGL MNTHLY SUB OLV NL 1M ADDTL PROD PERUSR
T3V-00009 - BINGMAPSUSRSBVL OLV C 1MTH 5KBNDL 1USR T5D-01799 - OFFICE HMEBSSS 2013 32-BT/X64 SPASHUS/PR
T3V-00013 - BINGMAPSVL OLV D 1MTH 5KBNDL 1USR AAA-02875 - OFFICE HOME AND STUDENT 2013 32/64 EN
T9V-00011 - BINGMAPSWBST SBSVL OLV D 1MTH 250KTRSCTS T5D-01575 - OFFICE HOME BSISS 2013 32/64 EGLSH NA
T9V-00006 - BINGMAPSWBST SBSVL OLVD1MTH100KTRSCTS 79G-03550 - OFFICE HOME STDNT 2013 32-BIT/X64 ENGLIH
D75-00772 - BIZTALK SERVER STD ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD 1 PROCESSOR A9S-00030 - OFFICE LCS CONNCT PBLC IM MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD PER
LQD-00006 - BM DTOP WECPMONLY OV1LICLD ADDPROD 1MON BT1-00023 - OFFICE LIVE MTG STD SNGL MNTHLY SUBSCRPTN OLV NL 1M ADTLPROD PER USER
LQD-00006 - BM DTOP WECPMONLY OV1LICLD ADDPROD 1MON BT1-00023 - OFFICE LIVE MTG STD SNGL MNTHLY SUBSCRPTN OLV NL 1M ADTLPROD PER USER
SFA-00064 - BM OV 1LIC LD ADD PROD 250K TRANS 1MON 731-01247 - OFFICE MAC ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
SFA-00064 - BM OV 1LIC LD ADD PROD 250K TRANS 1MON GZA-00267 - OFFICE MAC HME STDT 2011 EGLSH NA MEDLSS
SFA-00072 - BM OV 1LIC LD ADD PROD 25K TRANS 1MON 3YF-00191 - OFFICE MAC STANDARD ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE
SFA-00072 - BM OV 1LIC LD ADD PROD 25K TRANS 1MON 3YF-00177 - OFFICE MAC STANDARD ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE
SFA-00056 - BM OV 1LIC LD ADD PROD UNLIM ADD ON 1MON 3YF-00178 - OFFICE MAC STD ALL LNG LICENSE/SOFTWARE
SFA-00056 - BM OV 1LIC LD ADD PROD UNLIM ADD ON 1MON 79H-00070 - Office Multi Lang Pack Lic/SA Pack OLP C
SFA-00008 - BM OV 1LIC NL ADD PROD PER USER 1MON 79H-00072 - Office Multi Lang Pack Lic/SA Pack OLP NL
SFA-00008 - BM OV 1LIC NL ADD PROD PER USER 1MON 79H-00068 - Office Multi Lang Pack Lic/SA Pack OLP NL Locl Govt
LMD-00011 - BM SER OV 1LIC LD ADD PROD DEVICE 1MON 79H-00073 - Office Multi Lang Pack SA OLP C
LMD-00011 - BM SER OV 1LIC LD ADD PROD DEVICE 1MON 79H-00075 - Office Multi Lang Pack SA OLP NL
LMD-00012 - BM SER OV 1LIC LD ADD PROD USER 1MON 79H-00069 - Office Multi Lang Pack SA OLP NL Locl Govt
LMD-00012 - BM SER OV 1LIC LD ADD PROD USER 1MON 269-09977 - Office Pro 2003 Win32 1 PK SP2
LMD-00012 - BM SER OV 1LIC LD ADD PROD USER 1MON 269-09645 - OFFICE PRO ALL LNG LIC/SA PACK OLV NL 1YR ACQ Y1 ENT
LMD-00008 - BM SER OV 1LIC NL ADD PROD USER 1MON 269-09643 - OFFICE PRO ALL LNG LIC/SA PACK OLV NL 3YR ACQ Y1 ENT
LPD-00011 - BM SER WECP OV 1LIC LD ADD PROD 1MON 269-09657 - OFFICE PRO ALL LNG SA OLV NL 1YR ACQ Y1 ENT
LPD-00011 - BM SER WECP OV 1LIC LD ADD PROD 1MON 269-09751 - OFFICE PRO ALL LNG SA OLV NL 3YR ACQ Y1 ENT
LPD-00012 - BM SER WECP OV 1LIC LD ADD PROD UR 1MON 269-09046 - OFFICE PRO ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
LPD-00012 - BM SER WECP OV 1LIC LD ADD PROD UR 1MON 269-09050 - OFFICE PRO ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
LPD-00012 - BM SER WECP OV 1LIC LD ADD PROD UR 1MON 269-09061 - OFFICE PRO ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
LND-00018 - BM SER WECPMON OV 1LIC LD ADD PROD 1MON 269-09065 - OFFICE PRO ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
LND-00018 - BM SER WECPMON OV 1LIC LD ADD PROD 1MON 269-09051 - OFFICE PRO ENGLISH SA STEP UP OLV NL 1YR ACQ Y1 ADDTL PROD
LLD-00007 - BM SERVER OV 1LIC NL ADD PROD 1MON 269-09059 - OFFICE PRO ENGLISH SA STEP UP OLV NL 3YR ACQ Y1 ADDTL PROD
LLD-00008 - BM SERVERMONLY OV 1LIC LD ADD PROD 1MON 269-09648 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
LLD-00008 - BM SERVERMONLY OV 1LIC LD ADD PROD 1MON 269-09649 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
D2M-00681 - BSNSSINTELLIGENCE 2014 ENGNL LCLGOV QLFD 79P-02338 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
F52-02250 - BTLKSVRT SASU OLV 2IC D 1Y AQY1SVRSTD 79P-02310 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
D75-01974 - BZTLKSRSTD LICSAPKOLP2IC NL LCLGOV QLFD 79P-02322 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
F52-02235 - BZTLKSVR SASU OLV 2IC D 2YAY2 BZTLKSRSTD 79P-02330 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
HJA-00759 - BZTLKSVRBRNCH LICSAPK OLP2LIC NL LCLGOV 79P-02358 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
HJA-00770 - BZTLKSVRBRNCH SA OLP 2LIC NL LCLGOV 79P-02370 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
HJA-00670 - BZTLKSVRBRNCH ALNG LICSAPK OLV 2LIC C 1Y 79P-02404 - OFFICE PROFESSIONAL PLUS ALL LNG LIC/SA
HJA-00684 - BZTLKSVRBRNCH ALNG LICSAPK OLV 2LIC D 1Y 79P-02374 - OFFICE PROFESSIONAL PLUS ALL LNG SA OLV
HJA-00674 - BZTLKSVRBRNCH LICSAPK OLV 2LIC D 1Y AQY1 79P-02314 - OFFICE PROFESSIONAL PLUS ALL LNG SA OLV
HJA-00678 - BZTLKSVRBRNCH LICSAPK OLV 2LIC D 1Y AQY2 269-09047 - OFFICE PROFESSIONAL PLUS ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD
HJA-00682 - BZTLKSVRBRNCH LICSAPK OLV 2LIC D 1Y AQY3 269-09049 - OFFICE PROFESSIONAL PLUS ENGLISH LIC/SA PACK OLV NL 2YR ACQ Y2 ADDTL PROD
HJA-00627 - BZTLKSVRBRNCH LICSAPK OLV 2LIC D 2Y AQY2 269-09064 - OFFICE PROFESSIONAL PLUS ENGLISH SA OLV NL 2YR ACQ Y2 ADDTL PROD
HJA-00717 - BZTLKSVRBRNCH LICSAPK OLV 2LIC D 3Y AQY1 W87-00912 - Office SB Ed 2003 Win32 English 1PK SP2
HJA-00675 - BZTLKSVRBRNCH SA OLV 2LIC D 1Y AQY1 AP W87-00356 - OFFICE SB ED ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
HJA-00679 - BZTLKSVRBRNCH SA OLV 2LIC D 1Y AQY2 AP H05-01752 - OFFICE SHAREPOINT CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD USER CAL
HJA-00683 - BZTLKSVRBRNCH SA OLV 2LIC D 1Y AQY3 AP H04-01506 - OFFICE SHAREPOINT SERVER ALL LNG LIC/SA
HJA-00628 - BZTLKSVRBRNCH SA OLV 2LIC D 2Y AQY2 AP H04-01317 - OFFICE SHAREPOINT SERVER ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD
HJA-00718 - BZTLKSVRBRNCH SA OLV 2LIC D 3Y AQY1 AP WIN+OFFOLPL - OFFICE STANDARD AND WINDOWS PRO UPGRADE PROMOTIONAL BUNDLE
HJA-00706 - BZTLKSVRBRNCH SNGL SA OLP 2LIC C CORELIC WIN+OFFOLPLSA - OFFICE STANDARD AND WINDOWS PRO UPGRADE PROMOTIONAL BUNDLE
HJA-00704 - BZTLKSVRBRNCHLICSAPK OLP 2LIC C CORELIC 6GQ-00024 - OFFICE365 HOME PREM 32/641YR NA MDLSS
HJA-00768 - BZTLKSVRBRNCHLICSAPK OLP 2LIC NL ACDMC R4T-00042 - OFFICE365 UNSTY 32/64 EN4YR AE US/CANADA
HJA-00783 - BZTLKSVRBRNCHLICSAPK OLP 2LIC NL CHRTY 7JT-00002 - OFFICE365E1ARCHVSBSVL OLV D 1MTH AP
HJA-00705 - BZTLKSVRBRNCHLICSAPK OLP 2LIC NL CORELIC Q4Y-00005 - OFFICE365E1OPSBSVL OLV D 1MTH AP
HJA-00614 - BZTLKSVRBRNCHLICSAPK OLV 2LIC C 1Y AQY1 Q5Y-00005 - OFFICE365E3OP SHRDSVR SBSVL OLV D1MTH AP
HJA-00650 - BZTLKSVRBRNCHLICSAPK OLV 2LIC C 1Y AQY2 Q5Y-00007 - OFFICE365E3OSBSVL OLP NL LCLGOV QLFD
HJA-00666 - BZTLKSVRBRNCHLICSAPK OLV 2LIC C 1Y AQY3 7JT-00001-12 - OFFICE365PLANE1ARCH BSVL OLV D 1MTH AP
HJA-00621 - BZTLKSVRBRNCHLICSAPK OLV 2LIC C 2Y AQY2 Q4Y-00007 - OFFICE365PLANE1OP SBSVLOLCLGOV QLFD
HJA-00711 - BZTLKSVRBRNCHLICSAPK OLV 2LIC C 3Y AQY1 Q4Y-00001-12 - OFFICE365PLANE1OP SUBSVL OLV NL 1MTH AP
HJA-00600 - BZTLKSVRBRNCHLICSAPK OLV 2LIC E 1Y ACDMC Q4Y-00009 - OFFICE365PLANE1OPEN 1M AP ENT CORECAL
HJA-00601 - BZTLKSVRBRNCHLICSAPK OLV 2LIC F 1Y ACDMC Q4Y-00011 - OFFICE365PLANE1OPEN 1MTH AP ENT CORECAL
HJA-00671 - BZTLKSVRBRNCHLICSAPK OLV 2LIC NL 1Y Q4Y-00013 - OFFICE365PLANE1OPEN 1MTH APPLTFRMCORECAL
HJA-00615 - BZTLKSVRBRNCHLICSAPK OLV 2LIC NL 1Y AQY1 Q4Y-00010-12 - OFFICE365PLANE1OPEN D 1M AP ENTCORECAL
HJA-00651 - BZTLKSVRBRNCHLICSAPK OLV 2LIC NL 1Y AQY2 Q4Y-00008-12 - OFFICE365PLANE1OPEN NL 1M AP ENTCORECAL
HJA-00667 - BZTLKSVRBRNCHLICSAPK OLV 2LIC NL 1Y AQY3 Q4Y-00003 - OFFICE365PLANE1OPEN OLP NL ANNUAL QLFD
HJA-00622 - BZTLKSVRBRNCHLICSAPK OLV 2LIC NL 2Y AQY2 Q4Y-00002 - OFFICE365PLANE1OPEN OLV NL 1MTH AP
HJA-00712 - BZTLKSVRBRNCHLICSAPK OLV 2LIC NL 3Y AQY1 Q4Y-00004-12 - OFFICE365PLANE1OPSUBSVL OLV D 1MTH AP
HJA-00780 - BZTLKSVRBRNCHSA OLP 2LIC NL ACDMC CORE Q5Y-00014 - OFFICE365PLANE3OPEN NL 1M AP PLTFRMOPP
HJA-00784 - BZTLKSVRBRNCHSA OLP 2LIC NL CHRTY CORE Q5Y-00012 - OFFICE365PLANE3OPEN 1M AP PLTFRM OPP
HJA-00707 - BZTLKSVRBRNCHSA OLP 2LIC NL CORELIC Q5Y-00015 - OFFICE365PLANE3OPEN 1MTH AP PLTFRMOPP
HJA-00616 - BZTLKSVRBRNCHSA OLV 2LIC C 1Y AQY1 AP Q5Y-00009 - OFFICE365PLANE3OPEN 1MTH AP ENT OPP
HJA-00652 - BZTLKSVRBRNCHSA OLV 2LIC C 1Y AQY2 AP Q5Y-00011 - OFFICE365PLANE3OPEN 1MTH AP ENT OPP
HJA-00668 - BZTLKSVRBRNCHSA OLV 2LIC C 1Y AQY3 AP Q5Y-00013 - OFFICE365PLANE3OPEN 1MTH AP PLTFRM OPP
HJA-00623 - BZTLKSVRBRNCHSA OLV 2LIC C 2Y AQY2 AP Q5Y-00019 - OFFICE365PLANE3OPEN AP ENT CALSTEW/OPP
HJA-00713 - BZTLKSVRBRNCHSA OLV 2LIC C 3Y AQY1 AP Q5Y-00010-12 - OFFICE365PLANE3OPEN D 1MTH AP ENTOPP
HJA-00617 - BZTLKSVRBRNCHSA OLV 2LIC NL 1Y AQY1 AP Q5Y-00003 - OFFICE365PLANE3OPEN OLP NL ANNUAL QLFD
HJA-00653 - BZTLKSVRBRNCHSA OLV 2LIC NL 1Y AQY2 AP Q5Y-00002 - OFFICE365PLANE3OPEN OLV NL 1MTH AP
HJA-00669 - BZTLKSVRBRNCHSA OLV 2LIC NL 1Y AQY3 AP Q5Y-00004-12 - OFFICE365PLANE3OPSUBSVL OLV D 1MTH AP
HJA-00624 - BZTLKSVRBRNCHSA OLV 2LIC NL 2Y AQY2 AP Q5Y-00001-12 - OFFICE365PLANE3OPSUBSVL OLV NL 1MTH AP
HJA-00714 - BZTLKSVRBRNCHSA OLV 2LIC NL 3Y AQY1 AP KLA-00506 - OFFICECOMMSSVRSTDCALLICSAPKOLVD1YAQ
R04-01119 - BZTLKSVRDEV 2013R2 ENG OLP NL LCLGOV 021-07259 - OFFICEENGLISHLIC/SAPACKOLVNL1YRACQY3ADDT
R04-01107 - BZTLKSVRDEV 2013R2 SNGL OLP C 021-07263 - OFFICEENGLISHSAOLVNL1YRACQY3ADDTLPROD
R04-01108 - BZTLKSVRDEV 2013R2 SNGL OLP NL 021-07265 - OFFICEENGLISHSAOLVNL2YRACQY2ADDTLPROD
F52-02140 - BZTLKSVRENT SA OLP 2LIC NL LCLGOV QLFD 79U-01210 - OFFICEGROOVEENTSRVCS ALNG SUBSVL OLV C 1
F52-02544 - BZTLKSVRENT 2013R2 SNGL 2LIC C CORELIC 79U-01211 - OFFICEGROOVEENTSRVCS ALNG SUBSVL OLV C 1
F52-02545 - BZTLKSVRENT 2013R2 SNGL 2LIC NL CORELIC 79U-01210 - OFFICEGROOVEENTSRVCS ALNG SUBSVL OLV C 1
F52-02035 - BZTLKSVRENT ALNG LICSAPK OLV 2LIC C 1Y 79U-01211 - OFFICEGROOVEENTSRVCS ALNG SUBSVL OLV C 1
F52-02059 - BZTLKSVRENT ALNG LICSAPK OLV 2LIC D 1Y 79U-01188 - OFFICEGROOVEENTSRVCS ALNG SUBSVL OLV D 1
F52-02036 - BZTLKSVRENT ALNG LICSAPK OLV 2LIC NL 1Y 79U-01191 - OFFICEGROOVEENTSRVCS ALNG SUBSVL OLV D 1
F52-02139 - BZTLKSVRENT LICSAPK OLP2IC NL LCLGOVQLFD 79U-01188 - OFFICEGROOVEENTSRVCS ALNG SUBSVL OLV D 1
F52-02039 - BZTLKSVRENT LICSAPK OLV 2LIC D 1Y AQY1 79U-01191 - OFFICEGROOVEENTSRVCS ALNG SUBSVL OLV D 1
F52-02043 - BZTLKSVRENT LICSAPK OLV 2LIC D 1Y AQY2 79U-01164 - OFFICEGROOVEENTSRVCS SUBSVL 1MTHPERDVC
F52-02057 - BZTLKSVRENT LICSAPK OLV 2LIC D 1Y AQY3 79U-01164 - OFFICEGROOVEENTSRVCS SUBSVL 1MTHPERDVC
F52-01982 - BZTLKSVRENT LICSAPK OLV 2LIC D 2Y AQY2 79U-01102 - OFFICEGROOVEENTSRVCS SUBSVL 1MTHPERUSR
F52-02032 - BZTLKSVRENT LICSAPK OLV 2LIC D 3Y AQY1 79U-01102 - OFFICEGROOVEENTSRVCS SUBSVL 1MTHPERUSR
F52-02040 - BZTLKSVRENT SA OLV 2LIC D 1Y AQY1 AP 79U-01226 - OFFICEGROOVEENTSRVCSSNGLSUBSVLOLVC1
F52-02044 - BZTLKSVRENT SA OLV 2LIC D 1Y AQY2 AP 79U-01227 - OFFICEGROOVEENTSRVCSSNGLSUBSVLOLVC1
F52-02058 - BZTLKSVRENT SA OLV 2LIC D 1Y AQY3 AP 79U-01226 - OFFICEGROOVEENTSRVCSSNGLSUBSVLOLVC1
F52-01983 - BZTLKSVRENT SA OLV 2LIC D 2Y AQY2 AP 79U-01227 - OFFICEGROOVEENTSRVCSSNGLSUBSVLOLVC1
F52-02033 - BZTLKSVRENT SA OLV 2LIC D 3Y AQY1 AP 79U-01192 - OFFICEGROOVEENTSRVCSSUBSVLOLVD1MTHA
F52-02249 - BZTLKSVRENT SASU OLV 2IC D 1Y AQY1 BRNCH 79U-01189 - OFFICEGROOVEENTSRVCSSUBSVLOLVD1MTHA
F52-02257 - BZTLKSVRENT SASU OLV 2IC D 1Y AQY3 BRNCH 79U-01192 - OFFICEGROOVEENTSRVCSSUBSVLOLVD1MTHA
F52-02253 - BZTLKSVRENT SASU OLV 2IC D 1YAQY2 BRNCH 79U-01189 - OFFICEGROOVEENTSRVCSSUBSVLOLVD1MTHA
F52-02254 - BZTLKSVRENT SASU OLV 2IC D 1YAQY2 SVRSTD A9S-00068 - OFFICELCSCNNCTPBLCIM ALNG SUBSVL OLV C 1
F52-02280 - BZTLKSVRENT SASU OLV 2IC D 3Y AQY SVRSTD A9S-00068 - OFFICELCSCNNCTPBLCIM ALNG SUBSVL OLV C 1
F52-02279 - BZTLKSVRENT SASU OLV 2IC D 3Y AQY1 BRNCH A9S-00057 - OFFICELCSCNNCTPBLCIM ALNG SUBSVL OLV D 1
F52-02258 - BZTLKSVRENT SASU OLV 2ICD1YAQY3 BZTLKSTD A9S-00057 - OFFICELCSCNNCTPBLCIM ALNG SUBSVL OLV D 1
F52-02234 - BZTLKSVRENT SASU OLV 2LIC D 2YAY2 BRNCH A9S-00072 - OFFICELCSCNNCTPBLCIMSNGLSUBSVLOLVC1
F52-02106 - BZTLKSVRENT SNGL SA OLP 2LIC C CORELIC A9S-00072 - OFFICELCSCNNCTPBLCIMSNGLSUBSVLOLVC1
F52-02104 - BZTLKSVRENTLICSAPK OLP 2LIC C CORELIC A9S-00056 - OFFICELCSCNNCTPBLCIMSUBSVLOLVD1MTHA
F52-02105 - BZTLKSVRENTLICSAPK OLP 2LIC NL CORE QLFD A9S-00056 - OFFICELCSCNNCTPBLCIMSUBSVLOLVD1MTHA
F52-01969 - BZTLKSVRENTLICSAPK OLV 2LIC C 1Y AQY1 AP 77D-00078 - OFFICEMULTILANGPK 2010 32BITX64 BRZLN
F52-02005 - BZTLKSVRENTLICSAPK OLV 2LIC C 1Y AQY2 AP 79H-00465 - OFFICEMULTILANGPK 2013 ENG OLP NL LCLGOV
F52-02021 - BZTLKSVRENTLICSAPK OLV 2LIC C 1Y AQY3 AP 79H-00457 - OFFICEMULTILANGPK 2013 SNGL OLP C
F52-01976 - BZTLKSVRENTLICSAPK OLV 2LIC C 2Y AQY2 AP 79H-00458 - OFFICEMULTILANGPK 2013 SNGL OLP NL
F52-02026 - BZTLKSVRENTLICSAPK OLV 2LIC C 3Y AQY1 AP 269-09048 - OFFICEPROFESSIONALPLUSENGLISHLIC/SAPACKO
F52-01945 - BZTLKSVRENTLICSAPK OLV 2LIC E 1Y ACDMC 269-09062 - OFFICEPROFESSIONALPLUSENGLISHSAOLVNL1YRA
F52-01946 - BZTLKSVRENTLICSAPK OLV 2LIC F 1Y ACDMC 269-09063 - OFFICEPROFESSIONALPLUSENGLISHSAOLVNL1YRA
F52-02075 - BZTLKSVRENTSA OLP 2LIC NL ACDMC QLFD 79P-04478 - OFFICEPROPLUS 2013 32BITX64
F52-02079 - BZTLKSVRENTSA OLP 2LIC NL CHRTY QLFD 79P-04702 - OFFICEPROPLUS 2013 ALNG OLV NL EAPLTFRM
F52-02107 - BZTLKSVRENTSA OLP 2LIC NL CORELIC QLFD 79P-04770 - OFFICEPROPLUS 2013 ENG OLP NL LCLGOV
F52-01971 - BZTLKSVRENTSA OLV 2LIC C 1Y AQY1 AP CORE 79P-04748 - OFFICEPROPLUS 2013 SNGL OLP C
F52-02007 - BZTLKSVRENTSA OLV 2LIC C 1Y AQY2 AP CORE 79P-04749 - OFFICEPROPLUS 2013 SNGL OLP NL
F52-02023 - BZTLKSVRENTSA OLV 2LIC C 1Y AQY3 AP CORE 269-09656 - OFFICEPROPLUS ALNG LICSAPK OLV C 1Y ENT
F52-01978 - BZTLKSVRENTSA OLV 2LIC C 2Y AQY2 AP CORE 79P-02403 - OFFICEPROPLUS ALNG LICSAPK OLV C 1Y PLTF
F52-02028 - BZTLKSVRENTSA OLV 2LIC C 3Y AQY1 AP CORE 79P-02337 - OFFICEPROPLUS ALNG LICSAPK OLV C 1Y PLTF
F52-01972 - BZTLKSVRENTSA OLV 2LIC NL 1Y AQY1 AP 269-10041 - OFFICEPROPLUS ALNG LICSAPK OLV C 1Y UTD
F52-02008 - BZTLKSVRENTSA OLV 2LIC NL 1Y AQY2 AP 79P-01717 - OFFICEPROPLUS ALNG LICSAPK OLV D 1Y ENT
F52-02024 - BZTLKSVRENTSA OLV 2LIC NL 1Y AQY3 AP 79P-02355 - OFFICEPROPLUS ALNG LICSAPK OLV D 1Y PLTF
F52-01979 - BZTLKSVRENTSA OLV 2LIC NL 2Y AQY2 AP 79P-02407 - OFFICEPROPLUS ALNG LICSAPK OLV D 1Y PLTF
F52-02029 - BZTLKSVRENTSA OLV 2LIC NL 3Y AQY1 AP 79P-01718 - OFFICEPROPLUS ALNG LICSAPK OLV D 1Y UTD
F52-02073 - BZTLKSVRLICSAPK OLP 2LIC NL ACDMC QLFD 79P-02706 - OFFICEPROPLUS ENG OLP NL LCLGOV RENTAL
F52-02078 - BZTLKSVRLICSAPK OLP 2LIC NL CHRTY QLFD 79P-02693 - OFFICEPROPLUS SNGL OLP C RENTAL
F52-02027 - BZTLKSVRLICSAPK OLV 2LIC C 3Y AQY1 79P-02695 - OFFICEPROPLUS SNGL OLP NL RENTAL
F52-01970 - BZTLKSVRLICSAPK OLV 2LIC NL 1Y AQY1 79P-03025 - OFFICEPROPLUS SNGL SA OLV NL 1Y AQY1 AP MSPROMO
F52-02006 - BZTLKSVRLICSAPK OLV 2LIC NL 1Y AQY2 269-09653 - OFFICEPROPLUSALNGLICSAPKOLVC1YAQY1
F52-02022 - BZTLKSVRLICSAPK OLV 2LIC NL 1Y AQY3 79P-02309 - OFFICEPROPLUSALNGLICSAPKOLVC1YAQY1
F52-01977 - BZTLKSVRLICSAPK OLV 2LIC NL 2Y AQY2 269-09654 - OFFICEPROPLUSALNGLICSAPKOLVC1YAQY2
D75-01975 - BZTLKSVRSTD SA OLP 2LIC NL LCLGOV QLFD 79P-02321 - OFFICEPROPLUSALNGLICSAPKOLVC1YAQY2
D75-02255 - BZTLKSVRSTD 2013R2 SNGL 2LIC C CORELIC 269-09655 - OFFICEPROPLUSALNGLICSAPKOLVC1YAQY3
D75-02256 - BZTLKSVRSTD 2013R2 SNGL 2LIC NL CORELIC 79P-02329 - OFFICEPROPLUSALNGLICSAPKOLVC1YAQY3
D75-01776 - BZTLKSVRSTD ALNG LICSAPK OLV 2LIC C 1Y 79P-02357 - OFFICEPROPLUSALNGLICSAPKOLVC2YAQY2
D75-01818 - BZTLKSVRSTD ALNG LICSAPK OLV 2LIC D 1Y 269-09652 - OFFICEPROPLUSALNGLICSAPKOLVC2YAQY2
D75-01777 - BZTLKSVRSTD ALNG LICSAPK OLV 2LIC NL 1Y 269-09651 - OFFICEPROPLUSALNGLICSAPKOLVC3YAQY1
D75-01783 - BZTLKSVRSTD LICSAPK OLV 2LIC D 1Y AQY1 79P-02369 - OFFICEPROPLUSALNGLICSAPKOLVC3YAQY1
D75-01799 - BZTLKSVRSTD LICSAPK OLV 2LIC D 1Y AQY2 79P-02341 - OFFICEPROPLUSALNGLICSAPKOLVD1YAQY1
D75-01815 - BZTLKSVRSTD LICSAPK OLV 2LIC D 1Y AQY3 79P-01714 - OFFICEPROPLUSALNGLICSAPKOLVD1YAQY1
D75-02027 - BZTLKSVRSTD LICSAPK OLV 2LIC D 2Y AQY2 79P-01715 - OFFICEPROPLUSALNGLICSAPKOLVD1YAQY2
D75-01916 - BZTLKSVRSTD LICSAPK OLV 2LIC D 3Y AQY1 79P-02347 - OFFICEPROPLUSALNGLICSAPKOLVD1YAQY2
D75-01795 - BZTLKSVRSTD SA OLV 2LIC D 1Y AQY1 AP 79P-01716 - OFFICEPROPLUSALNGLICSAPKOLVD1YAQY3
D75-01801 - BZTLKSVRSTD SA OLV 2LIC D 1Y AQY2 AP 79P-02351 - OFFICEPROPLUSALNGLICSAPKOLVD1YAQY3
D75-01817 - BZTLKSVRSTD SA OLV 2LIC D 1Y AQY3 AP 79P-02365 - OFFICEPROPLUSALNGLICSAPKOLVD2YAQY2
D75-02029 - BZTLKSVRSTD SA OLV 2LIC D 2Y AQY2 AP 79P-01713 - OFFICEPROPLUSALNGLICSAPKOLVD2YAQY2
D75-01918 - BZTLKSVRSTD SA OLV 2LIC D 3Y AQY1 AP 79P-01712 - OFFICEPROPLUSALNGLICSAPKOLVD3YAQY1
D75-01784 - BZTLKSVRSTD SASU OLV 2IC D 1Y AQY1 BRNCH 79P-02381 - OFFICEPROPLUSALNGLICSAPKOLVD3YAQY1
D75-01816 - BZTLKSVRSTD SASU OLV 2IC D 1Y AQY3 BRNCH 269-09650 - OFFICEPROPLUSALNGSAOLVC1YAQY1ENT
D75-01800 - BZTLKSVRSTD SASU OLV 2IC D 1YAQY2 BRNCH 79P-02313 - OFFICEPROPLUSALNGSAOLVC1YAQY1PLTF
D75-01917 - BZTLKSVRSTD SASU OLV 2IC D 3Y AQY1 BRNCH 269-09750 - OFFICEPROPLUSALNGSAOLVC3YAQY1ENT
D75-02028 - BZTLKSVRSTD SASU OLV 2LIC D 2YAY2 BRNCH 79P-02373 - OFFICEPROPLUSALNGSAOLVC3YAQY1PLTF
D75-02017 - BZTLKSVRSTD SNGL SA OLP 2LIC C CORELIC 79P-01719 - OFFICEPROPLUSALNGSAOLVD1YAQY1ENT
D75-02014 - BZTLKSVRSTDLICSAPK OLP 2LIC C CORELIC 79P-02343 - OFFICEPROPLUSALNGSAOLVD1YAQY1PLTF
D75-02016 - BZTLKSVRSTDLICSAPK OLP 2LIC NL CORE QLFD 79P-01738 - OFFICEPROPLUSALNGSAOLVD3YAQY1ENT
D75-01958 - BZTLKSVRSTDLICSAPK OLP 2LIC NLACDMC QLFD 79P-02383 - OFFICEPROPLUSALNGSAOLVD3YAQY1PLTF
D75-01963 - BZTLKSVRSTDLICSAPK OLP 2LIC NLCHRTY QLFD 269-09055 - OFFICEPROPLUSENGLISHSASTEPUPOLVNL1YRACQY
D75-01787 - BZTLKSVRSTDLICSAPK OLV 2LIC C 1Y AQY1 AP 269-09053 - OFFICEPROPLUSENGLISHSASTEPUPOLVNL1YRACQY
D75-01831 - BZTLKSVRSTDLICSAPK OLV 2LIC C 1Y AQY2 AP 269-09057 - OFFICEPROPLUSENGLISHSASTEPUPOLVNL2YRACQY
D75-01885 - BZTLKSVRSTDLICSAPK OLV 2LIC C 1Y AQY3 AP 79P-01692 - OFFICEPROPLUSLICSAPKOLVD1YAQY1AP
D75-01877 - BZTLKSVRSTDLICSAPK OLV 2LIC C 2Y AQY2 AP 79P-01693 - OFFICEPROPLUSLICSAPKOLVD1YAQY2AP
D75-01907 - BZTLKSVRSTDLICSAPK OLV 2LIC C 3Y AQY1 AP 79P-01694 - OFFICEPROPLUSLICSAPKOLVD1YAQY3AP
D75-01755 - BZTLKSVRSTDLICSAPK OLV 2LIC E 1Y ACDMC 79P-01695 - OFFICEPROPLUSLICSAPKOLVD2YAQY2AP
D75-01756 - BZTLKSVRSTDLICSAPK OLV 2LIC F 1Y ACDMC 79P-01696 - OFFICEPROPLUSLICSAPKOLVD3YAQY1AP
D75-01788 - BZTLKSVRSTDLICSAPK OLV 2LIC NL 1Y AQY1 79P-01707 - OFFICEPROPLUSSAOLVD1YAQY1AP
D75-01832 - BZTLKSVRSTDLICSAPK OLV 2LIC NL 1Y AQY2 79P-01709 - OFFICEPROPLUSSAOLVD1YAQY2AP
D75-01886 - BZTLKSVRSTDLICSAPK OLV 2LIC NL 1Y AQY3 79P-01708 - OFFICEPROPLUSSAOLVD1YAQY3AP
D75-01878 - BZTLKSVRSTDLICSAPK OLV 2LIC NL 2Y AQY2 79P-01710 - OFFICEPROPLUSSAOLVD2YAQY2AP
D75-01908 - BZTLKSVRSTDLICSAPK OLV 2LIC NL 3Y AQY1 79P-01711 - OFFICEPROPLUSSAOLVD3YAQY1AP
D75-01960 - BZTLKSVRSTDSA OLP 2LIC NL ACDMC QLFD 79P-01697 - OFFICEPROPLUSSASUOLVD1YAQY1FROMOFF
D75-01964 - BZTLKSVRSTDSA OLP 2LIC NL CHRTY QLFD 79P-01699 - OFFICEPROPLUSSASUOLVD1YAQY2FROMOFF
D75-02018 - BZTLKSVRSTDSA OLP 2LIC NL CORELIC QLFD 79P-01701 - OFFICEPROPLUSSASUOLVD1YAQY3FROMOFF
D75-01791 - BZTLKSVRSTDSA OLV 2LIC C 1Y AQY1 AP CORE 79P-01703 - OFFICEPROPLUSSASUOLVD2YAQY2FROMOFF
D75-01845 - BZTLKSVRSTDSA OLV 2LIC C 1Y AQY2 AP CORE 79P-01705 - OFFICEPROPLUSSASUOLVD3YAQY1FROMOFF
D75-01889 - BZTLKSVRSTDSA OLV 2LIC C 1Y AQY3 AP CORE H05-01749 - OFFICESHAREPOINTCALENGLISHLIC/SAOLVNL1YR
D75-01881 - BZTLKSVRSTDSA OLV 2LIC C 2Y AQY2 AP CORE H05-01753 - OFFICESHAREPOINTCALENGLISHLIC/SAOLVNL1YR
D75-01911 - BZTLKSVRSTDSA OLV 2LIC C 3Y AQY1 AP CORE H05-01754 - OFFICESHAREPOINTCALENGLISHLIC/SAOLVNL2YR
D75-01792 - BZTLKSVRSTDSA OLV 2LIC NL 1Y AQY1 AP H05-01755 - OFFICESHAREPOINTCALENGLISHLIC/SAOLVNL2YR
D75-01846 - BZTLKSVRSTDSA OLV 2LIC NL 1Y AQY2 AP H05-01763 - OFFICESHAREPOINTCALENGLISHSAOLVNL1YRACQY
D75-01775 - BZTLKSVRSTDSA OLV 2LIC NL 1Y AQY3 AP H05-01760 - OFFICESHAREPOINTCALENGLISHSAOLVNL1YRACQY
D75-01882 - BZTLKSVRSTDSA OLV 2LIC NL 2Y AQY2 AP H05-01764 - OFFICESHAREPOINTCALENGLISHSAOLVNL2YRACQY
D75-01912 - BZTLKSVRSTDSA OLV 2LIC NL 3Y AQY1 AP H05-01765 - OFFICESHAREPOINTCALENGLISHSAOLVNL2YRACQY
D75-01757 - BZTLKSVRSTDSASU OLV 2IC E 1Y ACDMC BRNCH 76M-01042 - OFFICESHAREPOINTCALLICSAPKOLVD1YAQY
D75-01758 - BZTLKSVRSTDSASU OLV 2IC F 1Y ACDMC BRNCH 76M-01038 - OFFICESHAREPOINTCALLICSAPKOLVD1YAQY
D75-01790 - BZTLKSVRSTDSASU OLV 2IC NL 1Y AQY1 BRNCH 76M-01041 - OFFICESHAREPOINTCALLICSAPKOLVD1YAQY
D75-01888 - BZTLKSVRSTDSASU OLV 2IC NL 1Y AQY3 BRNCH 76M-01037 - OFFICESHAREPOINTCALLICSAPKOLVD1YAQY
D75-01834 - BZTLKSVRSTDSASU OLV 2IC NL 1YAQY2 BRNCH 76M-01040 - OFFICESHAREPOINTCALLICSAPKOLVD1YAQY
D75-01910 - BZTLKSVRSTDSASU OLV 2IC NL 3Y AQY1 BRNCH 76M-01039 - OFFICESHAREPOINTCALLICSAPKOLVD1YAQY
D75-01789 - BZTLKSVRSTDSASU OLV 2LIC C 1Y AQY1 BRNCH 76M-01043 - OFFICESHAREPOINTCALLICSAPKOLVD2YAQY
D75-01833 - BZTLKSVRSTDSASU OLV 2LIC C 1Y AQY2 BRNCH 76M-01044 - OFFICESHAREPOINTCALLICSAPKOLVD2YAQY
D75-01887 - BZTLKSVRSTDSASU OLV 2LIC C 1Y AQY3 BRNCH 76M-01046 - OFFICESHAREPOINTCALLICSAPKOLVD3YAQY
D75-01778 - BZTLKSVRSTDSASU OLV 2LIC C 1Y BRNCH 76M-01045 - OFFICESHAREPOINTCALLICSAPKOLVD3YAQY
D75-01879 - BZTLKSVRSTDSASU OLV 2LIC C 2YAY2 BRNCH 76M-01050 - OFFICESHAREPOINTCALSAOLVD1YAQY1AP
D75-01909 - BZTLKSVRSTDSASU OLV 2LIC C 3Y AQY1 BRNCH 76M-01047 - OFFICESHAREPOINTCALSAOLVD1YAQY1AP
D75-01819 - BZTLKSVRSTDSASU OLV 2LIC D 1Y BRNCH 76M-01049 - OFFICESHAREPOINTCALSAOLVD1YAQY2AP
D75-01779 - BZTLKSVRSTDSASU OLV 2LIC NL 1Y BRNCH 76M-01052 - OFFICESHAREPOINTCALSAOLVD1YAQY2AP
D75-01880 - BZTLKSVRSTDSASU OLV 2LIC NL 2YAY2 BRNCH 76M-01051 - OFFICESHAREPOINTCALSAOLVD1YAQY3AP
F52-02215 - BZTLKSVSASU OLV 2IC C 1YAQY2 BZTLKSVRSTD 76M-01048 - OFFICESHAREPOINTCALSAOLVD1YAQY3AP
F52-02275 - BZTLKSVSASU OLV 2IC C 3YAQY1 BZTLKSVRSTD 76M-01053 - OFFICESHAREPOINTCALSAOLVD2YAQY2AP
F52-02241 - BZTLKSVSASU OLV 2IC C1Y AQY3 BZTLKSVRSTD 76M-01054 - OFFICESHAREPOINTCALSAOLVD2YAQY2AP
F52-02216 - BZTLKSVSASU OLV 2IC NL 1YAQY2BZTLKSVRSTD 76M-01056 - OFFICESHAREPOINTCALSAOLVD3YAQY1AP
F52-02231 - BZTLKSVSASU OLV 2IC NL 2YAY2 BZTLKSVRSTD 76M-01055 - OFFICESHAREPOINTCALSAOLVD3YAQY1AP
F52-02190 - BZTLKSVSASU OLV 2IC NL1Y AQY1BZTLKSVRSTD H04-01318 - OFFICESHAREPOINTSERVERENGLISHLIC/SAOLVNL
F52-02276 - BZTLKSVSASU OLV 2ICNL 3YAQY1 BZTLKSVRSTD H04-01319 - OFFICESHAREPOINTSERVERENGLISHLIC/SAOLVNL
F52-02187 - BZTLKSVSASU OLV 2LIC C 1Y AQY1 BRNCH H04-01323 - OFFICESHAREPOINTSERVERENGLISHSAOLVNL1YRA
F52-02213 - BZTLKSVSASU OLV 2LIC C 1Y AQY2 BRNCH H04-01322 - OFFICESHAREPOINTSERVERENGLISHSAOLVNL1YRA
F52-02229 - BZTLKSVSASU OLV 2LIC C 1Y AQY3 BRNCH H04-01324 - OFFICESHAREPOINTSERVERENGLISHSAOLVNL2YRA
F52-02243 - BZTLKSVSASU OLV 2LIC C 1Y BZTLKSVRBRNCH 76P-01051 - OFFICESHAREPOINTSVR ALNG LICSAPK OLV C 1
F52-02245 - BZTLKSVSASU OLV 2LIC C 1Y BZTLKSVRSTD 76P-00739 - OFFICESHAREPOINTSVR ALNG LICSAPK OLV D 1
F52-02208 - BZTLKSVSASU OLV 2LIC C 2YAY2 BRNCH 76P-00729 - OFFICESHAREPOINTSVRLICSAPKOLVD1YAQY
F52-02210 - BZTLKSVSASU OLV 2LIC C 2YAY2 BZTLKSVRSTD 76P-00730 - OFFICESHAREPOINTSVRLICSAPKOLVD1YAQY
F52-02273 - BZTLKSVSASU OLV 2LIC C 3Y AQY1 BRNCH 76P-00731 - OFFICESHAREPOINTSVRLICSAPKOLVD1YAQY
F52-02259 - BZTLKSVSASU OLV 2LIC D 1Y BZTLKSVRBRNCH 76P-00732 - OFFICESHAREPOINTSVRLICSAPKOLVD2YAQY
F52-02260 - BZTLKSVSASU OLV 2LIC D 1Y BZTLKSVRSTD 76P-00733 - OFFICESHAREPOINTSVRLICSAPKOLVD3YAQY
F52-02171 - BZTLKSVSASU OLV 2LIC E 1Y ACDMC BRNCH 76P-00734 - OFFICESHAREPOINTSVRSAOLVD1YAQY1AP
F52-02172 - BZTLKSVSASU OLV 2LIC F 1Y ACDMC BRNCH 76P-00736 - OFFICESHAREPOINTSVRSAOLVD1YAQY2AP
F52-02188 - BZTLKSVSASU OLV 2LIC NL 1Y AQY1 BRNCH 76P-00735 - OFFICESHAREPOINTSVRSAOLVD1YAQY3AP
F52-02214 - BZTLKSVSASU OLV 2LIC NL 1Y AQY2 BRNCH 76P-00737 - OFFICESHAREPOINTSVRSAOLVD2YAQY2AP
F52-02230 - BZTLKSVSASU OLV 2LIC NL 1Y AQY3 BRNCH 76P-00738 - OFFICESHAREPOINTSVRSAOLVD3YAQY1AP
F52-02244 - BZTLKSVSASU OLV 2LIC NL 1Y BZTLKSVRBRNCH 76P-01033 - OFFICESHAREPOINTSVRSNGLLICSAPKOLVC1
F52-02246 - BZTLKSVSASU OLV 2LIC NL 1Y BZTLKSVRSTD 76P-01047 - OFFICESHAREPOINTSVRSNGLLICSAPKOLVC1
F52-02209 - BZTLKSVSASU OLV 2LIC NL 2YAY2 BRNCH 76P-01019 - OFFICESHAREPOINTSVRSNGLLICSAPKOLVC1
F52-02274 - BZTLKSVSASU OLV 2LIC NL 3Y AQY1 BRNCH 76P-01062 - OFFICESHAREPOINTSVRSNGLLICSAPKOLVC2
F52-02174 - BZTLKSVSASU OLV2IC E 1Y ADMC BZTLKSVRSTD 76P-01076 - OFFICESHAREPOINTSVRSNGLLICSAPKOLVC3
F52-02242 - BZTLKSVSASU OLV2IC NL1Y AQY3 BZTLKSVRSTD 76P-01020 - OFFICESHAREPOINTSVRSNGLSAOLVC1YAQY
F52-02189 - BZTLKSVSASUOLV 2IC C 1Y AQY1 BZTLKSVRSTD 76P-01034 - OFFICESHAREPOINTSVRSNGLSAOLVC1YAQY
F52-02173 - BZTLKSVSASUOLV 2IC EY ADMC BTLKSRSTD 76P-01048 - OFFICESHAREPOINTSVRSNGLSAOLVC1YAQY
T2Z-00061 - C 1Y AQY1 VSDPLYMNTSTD AP 2PROC 76P-01063 - OFFICESHAREPOINTSVRSNGLSAOLVC2YAQY
T2Z-00121 - C 1Y AQY2 VSDPLYMNTSTD AP 2PROC 76P-01077 - OFFICESHAREPOINTSVRSNGLSAOLVC3YAQY
T2Z-00026 - C 1Y AQY3 VSDPLYMNTSTD AP 2PROC 021-10278 - OFFICESTD 2013 ENG OLP NL LCLGOV
T2Z-00148 - C 2Y AQY2 VSDPLYMNTSTD AP 2PROC 021-10256 - OFFICESTD 2013 SNGL OLP C
YEG-00092 - CAL LNG LCSE ASRCE 1LCSE CL ADNL PRDT 1Y 021-10257 - OFFICESTD 2013 SNGL OLP NL
AAA-01468 - CAPTURE AND ORGANIZE NOTES, PICTURES, WEB PAGES AND OTHER MEDIA FROM VIRTUALLY A 021-09202 - OFFICESTD ALNG LICSAPK OLV C 1Y AP
AAA-01550 - CAPTURE AND ORGANIZE NOTES, PICTURES, WEB PAGES AND OTHER MEDIA FROM VIRTUALLY A 021-09108 - OFFICESTD ALNG LICSAPK OLV D 1Y AP
FUD-00936 - CISDATACTR ALNG LICSAPK MVL 2PROC 021-09274 - OFFICESTD ENG OLP NL LCLGOV RENTAL
FUD-00936 - CISDATACTR ALNG LICSAPK MVL 2PROC 021-09261 - OFFICESTD SNGL OLP C RENTAL
FUD-00053 - CISDATACTR ALNG LICSAPK OLV C 1Y AP 021-09263 - OFFICESTD SNGL OLP NL RENTAL
FUD-00869 - CISDATACTR ALNG LICSAPK OLV C 1Y AP 2PRO 021-08801 - OFFICESTDLICSAPKOLVD1YAQY1AP
FUD-00115 - CISDATACTR ALNG LICSAPK OLV D 1Y AP 021-08705 - OFFICESTDLICSAPKOLVD1YAQY2AP
FUD-00883 - CISDATACTR ALNG LICSAPK OLV D 1Y AP 2PRO 021-08706 - OFFICESTDLICSAPKOLVD1YAQY3AP
FUD-00054 - CISDATACTR ALNG LICSAPK OLV NL 1Y AP 021-08707 - OFFICESTDLICSAPKOLVD2YAQY2AP
FUD-00870 - CISDATACTR ALNG LICSAPK OLV NL 1Y AP 2PR 021-08708 - OFFICESTDLICSAPKOLVD3YAQY1AP
FUD-01238 - CISDATACTR ALNG SASU MVL CISSTD 2PROC 021-08709 - OFFICESTDSAOLVD1YAQY1AP
FUD-01238 - CISDATACTR ALNG SASU MVL CISSTD 2PROC 021-08711 - OFFICESTDSAOLVD1YAQY2AP
FUD-00055 - CISDATACTR ALNG SASU OLV C 1Y CISSTD AP 021-08710 - OFFICESTDSAOLVD1YAQY3AP
FUD-01209 - CISDATACTR ALNG SASU OLV C 1Y CISSTD AP2 021-08712 - OFFICESTDSAOLVD2YAQY2AP
FUD-00116 - CISDATACTR ALNG SASU OLV D 1Y CISSTD AP 021-08713 - OFFICESTDSAOLVD3YAQY1AP
FUD-00056 - CISDATACTR ALNG SASU OLV NL 1Y CISSTD AP 021-09152 - OFFICESTDSNGLLICSAPKOLVC1YAQY1AP
FUD-01217 - CISDATACTR ALNG SASU OLVD1YCISSTDAP2PROC 021-09174 - OFFICESTDSNGLLICSAPKOLVC1YAQY2AP
FUD-01210 - CISDATACTR ALNG SASUOLVNL1YCISSTDAP2PROC 021-09196 - OFFICESTDSNGLLICSAPKOLVC1YAQY3AP
FUD-01029 - CISDATACTR LICSAPK D 1Y AQY1 AP 021-09220 - OFFICESTDSNGLLICSAPKOLVC2YAQY2AP
FUD-01031 - CISDATACTR LICSAPK D 1Y AQY2 AP 021-09242 - OFFICESTDSNGLLICSAPKOLVC3YAQY1AP
FUD-01033 - CISDATACTR LICSAPK D 1Y AQY3 AP 021-09153 - OFFICESTDSNGLSAOLVC1YAQY1AP
FUD-01057 - CISDATACTR LICSAPK D 2Y AQY2 AP 021-09175 - OFFICESTDSNGLSAOLVC1YAQY2AP
FUD-01071 - CISDATACTR LICSAPK D 3Y AQY1 AP 021-09197 - OFFICESTDSNGLSAOLVC1YAQY3AP
FUD-01048 - CISDATACTR LICSAPK LCLGOV W/OSYSCTRSVR 021-09221 - OFFICESTDSNGLSAOLVC2YAQY2AP
FUD-00933 - CISDATACTR LICSAPK OLP NL LCLGOV 021-09243 - OFFICESTDSNGLSAOLVC3YAQY1AP
FUD-01147 - CISDATACTR LICSAPK OLP NL LCLGOV WO A9S-00031 - OFFLCSCONNCTPBLCIMALLNGMONTHLYOLVNL1MPER
FUD-00873 - CISDATACTR LICSAPK OLV D 1Y AQY1 AP A9S-00031 - OFFLCSCONNCTPBLCIMMONTHLYOLVNL1M
FUD-01118 - CISDATACTR LICSAPK OLV D 1Y AQY1 AP WO YEG-01371 - OLV C 1Y AQY1 PLTFRM FORECAL DVCCAL
FUD-00877 - CISDATACTR LICSAPK OLV D 1Y AQY2 AP YEG-01373 - OLV C 1Y AQY1 PLTFRM FORECAL USRCAL
FUD-01120 - CISDATACTR LICSAPK OLV D 1Y AQY2 AP WO YEG-01379 - OLV C 1Y AQY2 PLTFRM FORECAL DVCCAL
FUD-00881 - CISDATACTR LICSAPK OLV D 1Y AQY3 AP YEG-01381 - OLV C 1Y AQY2 PLTFRM FORECAL USRCAL
FUD-01122 - CISDATACTR LICSAPK OLV D 1Y AQY3 AP WO YEG-01383 - OLV C 1Y AQY3 PLTFRM FORECAL DVCCAL
FUD-00926 - CISDATACTR LICSAPK OLV D 2Y AQY2 AP YEG-01385 - OLV C 1Y AQY3 PLTFRM FORECAL USRCAL
FUD-01136 - CISDATACTR LICSAPK OLV D 2Y AQY2 AP WO YEG-01391 - OLV C 1Y PLTFRMUTD FORECAL DVCCAL
FUD-00966 - CISDATACTR LICSAPK OLV D 3Y AQY1 AP YEG-01393 - OLV C 1Y PLTFRMUTD FORECAL USRCAL
FUD-01156 - CISDATACTR LICSAPK OLV D 3Y AQY1 AP WO YEG-01407 - OLV C 2Y AQY2 PLTFRM FORECAL DVCCAL
FUD-00820 - CISDATACTR OLV F 1Y ACDMC AP 2PROC YEG-01409 - OLV C 2Y AQY2 PLTFRM FORECAL USRCAL
FUD-00934 - CISDATACTR SA OLP NL LCLGOV YEG-01413 - OLV C 3Y AQY1 PLTFRM FORECAL DVCCAL
FUD-00874 - CISDATACTR SA OLV D 1Y AQY1 AP 2PROC YEG-01415 - OLV C 3Y AQY1 PLTFRM FORECAL USRCAL
FUD-00878 - CISDATACTR SA OLV D 1Y AQY2 AP 2PROC YEG-01395 - OLV D 1Y AQY1 PLTFRM FORECAL DVCCAL
FUD-00882 - CISDATACTR SA OLV D 1Y AQY3 AP 2PROC YEG-01396 - OLV D 1Y AQY1 PLTFRM FORECAL USRCAL
FUD-00927 - CISDATACTR SA OLV D 2Y AQY2 AP 2PROC YEG-01399 - OLV D 1Y AQY2 PLTFRM FORECAL DVCCAL
FUD-00967 - CISDATACTR SA OLV D 3Y AQY1 AP 2PROC YEG-01400 - OLV D 1Y AQY2 PLTFRM FORECAL USRCAL
FUD-01212 - CISDATACTR SASU OLV D 1Y AQY1 CISSTD AP YEG-01401 - OLV D 1Y AQY3 PLTFRM FORECAL DVCCAL
FUD-01214 - CISDATACTR SASU OLV D 1Y AQY2 CISSTD AP YEG-01402 - OLV D 1Y AQY3 PLTFRM FORECAL USRCAL
FUD-01216 - CISDATACTR SASU OLV D 1Y AQY3 CISSTD AP YEG-01405 - OLV D 1Y PLTFRMUTD FORECAL DVCCAL
FUD-01227 - CISDATACTR SASU OLV D 2Y AQY2 CISSTD AP YEG-01406 - OLV D 1Y PLTFRMUTD FORECAL USRCAL
FUD-01237 - CISDATACTR SASU OLV D 3Y AQY1 CISSTD AP YEG-01411 - OLV D 2Y AQY2 PLTFRM FORECAL DVCCAL
FUD-01000 - CISDATACTR SNGL LICSAPK OLP C 2PROC YEG-01412 - OLV D 2Y AQY2 PLTFRM FORECAL USRCAL
FUD-01002 - CISDATACTR SNGL SA OLP C 2PROC YEG-01421 - OLV D 3Y AQY1 PLTFRM FORECAL DVCCAL
FUD-01003 - CISDATACTR SNGL SA OLP NL 2PROC QLFD YEG-01422 - OLV D 3Y AQY1 PLTFRM FORECAL USRCAL
FUD-01011 - CISDATACTRLICSAPK 1Y AQY1 AP YEG-01372 - OLV NL 1Y AQY1 PLTFRM FORECAL DVCCAL
FUD-01019 - CISDATACTRLICSAPK 1Y AQY2 AP YEG-01374 - OLV NL 1Y AQY1 PLTFRM FORECAL USRCAL
FUD-01027 - CISDATACTRLICSAPK 1Y AQY3 AP YEG-01380 - OLV NL 1Y AQY2 PLTFRM FORECAL DVCCAL
FUD-01055 - CISDATACTRLICSAPK 2Y AQY2 AP YEG-01382 - OLV NL 1Y AQY2 PLTFRM FORECAL USRCAL
FUD-01069 - CISDATACTRLICSAPK 3Y AQY1 AP YEG-01384 - OLV NL 1Y AQY3 PLTFRM FORECAL DVCCAL
FUD-01010 - CISDATACTRLICSAPK C 1Y AQY1 AP YEG-01386 - OLV NL 1Y AQY3 PLTFRM FORECAL USRCAL
FUD-01018 - CISDATACTRLICSAPK C 1Y AQY2 AP YEG-01392 - OLV NL 1Y PLTFRMUTD FORECAL DVCCAL
FUD-01026 - CISDATACTRLICSAPK C 1Y AQY3 AP YEG-01394 - OLV NL 1Y PLTFRMUTD FORECAL USRCAL
FUD-01054 - CISDATACTRLICSAPK C 2Y AQY2 AP YEG-01408 - OLV NL 2Y AQY2 PLTFRM FORECAL DVCCAL
FUD-01068 - CISDATACTRLICSAPK C 3Y AQY1 AP YEG-01410 - OLV NL 2Y AQY2 PLTFRM FORECAL USRCAL
FUD-01085 - CISDATACTRLICSAPK OLP C W/OSYSCTRSVRLIC YEG-01414 - OLV NL 3Y AQY1 PLTFRM FORECAL DVCCAL
FUD-01174 - CISDATACTRLICSAPK OLP C WO YEG-01416 - OLV NL 3Y AQY1 PLTFRM FORECAL USRCAL
FUD-01001 - CISDATACTRLICSAPK OLP NL 9TX-00312 - OMCLIENTOMLENGLICSAPACKOLVNL1YRACQY1ADDT
FUD-01086 - CISDATACTRLICSAPK OLP NL W/OSYSCTRSVRLIC S26-05028 - ONENOTE 2013 32-BIT/X64 ENGLSH MEDALESS
FUD-01175 - CISDATACTRLICSAPK OLP NL WO S26-05417 - ONENOTE 2013 ENG OLP NL LCLGOV
FUD-00833 - CISDATACTRLICSAPK OLV C 1Y AQY1 AP S26-05395 - ONENOTE 2013 SNGL OLP C
FUD-01099 - CISDATACTRLICSAPK OLV C 1Y AQY1 AP WO S26-05396 - ONENOTE 2013 SNGL OLP NL
FUD-00849 - CISDATACTRLICSAPK OLV C 1Y AQY2 AP S26-01776 - ONENOTE ALL LNG LIC/SA PK OLV NL 1YR ADD
FUD-01107 - CISDATACTRLICSAPK OLV C 1Y AQY2 AP WO S26-04027 - ONENOTE ALNG LICSAPK OLV C 1Y AP
FUD-00865 - CISDATACTRLICSAPK OLV C 1Y AQY3 AP S26-03459 - ONENOTE ALNG LICSAPK OLV D 1Y AP
FUD-01115 - CISDATACTRLICSAPK OLV C 1Y AQY3 AP WO S26-01425 - ONENOTE ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
FUD-00920 - CISDATACTRLICSAPK OLV C 2Y AQY2 AP S26-01427 - ONENOTE ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
FUD-01133 - CISDATACTRLICSAPK OLV C 2Y AQY2 AP WO S26-01435 - ONENOTE ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
FUD-00960 - CISDATACTRLICSAPK OLV C 3Y AQY1 AP S26-00098 - OneNote For Windows Standard Software Assurance 32-Bit Win License Only NO MEDIA
FUD-01153 - CISDATACTRLICSAPK OLV C 3Y AQY1 AP WO S26-00108 - OneNote For Windows Standard Software Assurance 32-Bit Win License Only NO MEDIA
FUD-00834 - CISDATACTRLICSAPK OLV NL 1Y AQY1 AP S26-00085 - OneNote For Windows Standard Software Assurance 32-Bit Win License Only NO MEDIA
FUD-01100 - CISDATACTRLICSAPK OLV NL 1Y AQY1 AP WO S26-00095 - OneNote For Windows Standard Software Assurance 32-Bit Win License Only NO MEDIA
FUD-00850 - CISDATACTRLICSAPK OLV NL 1Y AQY2 AP S26-00100 - OneNote For Windows Standard Software Assurance 32-Bit Win License Only NO MEDIA
FUD-01108 - CISDATACTRLICSAPK OLV NL 1Y AQY2 AP WO S26-00087 - OneNote For Windows Standard Software Assurance 32-Bit Win License Only NO MEDIA
FUD-00866 - CISDATACTRLICSAPK OLV NL 1Y AQY3 AP S26-01419 - ONENOTEENGLISHLIC/SAPACKOLVNL1YRACQY2ADD
FUD-01116 - CISDATACTRLICSAPK OLV NL 1Y AQY3 AP WO S26-01421 - ONENOTEENGLISHLIC/SAPACKOLVNL1YRACQY3ADD
FUD-00921 - CISDATACTRLICSAPK OLV NL 2Y AQY2 AP S26-01423 - ONENOTEENGLISHLIC/SAPACKOLVNL2YRACQY2ADD
FUD-01134 - CISDATACTRLICSAPK OLV NL 2Y AQY2 AP WO S26-01431 - ONENOTEENGLISHSAOLVNL1YRACQY2ADDTLPROD
FUD-00961 - CISDATACTRLICSAPK OLV NL 3Y AQY1 AP S26-01433 - ONENOTEENGLISHSAOLVNL2YRACQY2ADDTLPROD
FUD-01154 - CISDATACTRLICSAPK OLV NL 3Y AQY1 AP WO S26-03450 - ONENOTELICSAPKOLVD1YAQY2AP
FUD-00835 - CISDATACTRSA OLV C 1Y AQY1 AP S26-03451 - ONENOTELICSAPKOLVD1YAQY3AP
FUD-00851 - CISDATACTRSA OLV C 1Y AQY2 AP S26-03452 - ONENOTELICSAPKOLVD2YAQY2AP
FUD-00867 - CISDATACTRSA OLV C 1Y AQY3 AP S26-03453 - ONENOTELICSAPKOLVD3YAQY1AP
FUD-00922 - CISDATACTRSA OLV C 2Y AQY2 AP S26-03454 - ONENOTESAOLVD1YAQY1AP
FUD-00962 - CISDATACTRSA OLV C 3Y AQY1 AP S26-03456 - ONENOTESAOLVD1YAQY2AP
FUD-00836 - CISDATACTRSA OLV NL 1Y AQY1 AP S26-03455 - ONENOTESAOLVD1YAQY3AP
FUD-00852 - CISDATACTRSA OLV NL 1Y AQY2 AP S26-03457 - ONENOTESAOLVD2YAQY2AP
FUD-00868 - CISDATACTRSA OLV NL 1Y AQY3 AP S26-03458 - ONENOTESAOLVD3YAQY1AP
FUD-00923 - CISDATACTRSA OLV NL 2Y AQY2 AP S26-03977 - ONENOTESNGLLICSAPKOLVC1YAQY1AP
FUD-00963 - CISDATACTRSA OLV NL 3Y AQY1 AP S26-03999 - ONENOTESNGLLICSAPKOLVC1YAQY2AP
FUD-01191 - CISDATACTRSASU OLV C 1Y AQY1 CISSTD AP S26-04021 - ONENOTESNGLLICSAPKOLVC1YAQY3AP
FUD-01199 - CISDATACTRSASU OLV C 1Y AQY2 CISSTD AP S26-04045 - ONENOTESNGLLICSAPKOLVC2YAQY2AP
FUD-01207 - CISDATACTRSASU OLV C 1Y AQY3 CISSTD AP S26-04067 - ONENOTESNGLLICSAPKOLVC3YAQY1AP
FUD-01224 - CISDATACTRSASU OLV C 2Y AQY2 CISSTD AP S26-03978 - ONENOTESNGLSAOLVC1YAQY1AP
FUD-01234 - CISDATACTRSASU OLV C 3Y AQY1 CISSTD AP S26-04000 - ONENOTESNGLSAOLVC1YAQY2AP
FUD-01192 - CISDATACTRSASU OLV NL 1Y AQY1 CISSTD AP S26-04022 - ONENOTESNGLSAOLVC1YAQY3AP
FUD-01200 - CISDATACTRSASU OLV NL 1Y AQY2 CISSTD AP S26-04046 - ONENOTESNGLSAOLVC2YAQY2AP
FUD-01208 - CISDATACTRSASU OLV NL 1Y AQY3 CISSTD AP S26-04068 - ONENOTESNGLSAOLVC3YAQY1AP
FUD-01225 - CISDATACTRSASU OLV NL 2Y AQY2 CISSTD AP UAR-00730 - OPSMGRSERVERENGLICSAPACKOLVNL1YRACQY1ADD
FUD-01235 - CISDATACTRSASU OLV NL 3Y AQY1 CISSTD AP 35H-00006 - OPTICAL MOUSE 200 FOR BUSINESS USB PORT ENGLISH,BRAZILIAN,FRENCH,SPANISH MULTIPL
YJD-01075 - CISSTD ALNG LICSAPK MVL 2PROC 35H-00005 - OPTICAL MOUSE 200 FOR BUSINESS USB PORT ENGLISH,BRAZILIAN,FRENCH,SPANISH MULTIPL
YJD-01075 - CISSTD ALNG LICSAPK MVL 2PROC JUD-00001 - OPTICAL MOUSE 200 MAC/WIN USB EF EN/XC/FR/EL/IW/IT/PT/ES HDWR
YJD-00127 - CISSTD ALNG LICSAPK OLV C 1Y AP 543-06078 - OUTLK 2013 ENG OLP NL LCLGOV
YJD-00998 - CISSTD ALNG LICSAPK OLV C 1Y AP 2PROC 543-06056 - OUTLK 2013 SNGL OLP C
YJD-00141 - CISSTD ALNG LICSAPK OLV D 1Y AP 543-06057 - OUTLK 2013 SNGL OLP NL
YJD-01012 - CISSTD ALNG LICSAPK OLV D 1Y AP 2PROC 543-05013 - OUTLK ALNG LICSAPK OLV C 1Y AP
YJD-00037 - CISSTD ALNG LICSAPK OLV E 1Y ACDMC AP 543-04462 - OUTLK ALNG LICSAPK OLV D 1Y AP
YJD-00038 - CISSTD ALNG LICSAPK OLV F 1Y ACDMC AP 543-04452 - OUTLKLICSAPKOLVD1YAQY1AP
YJD-00128 - CISSTD ALNG LICSAPK OLV NL 1Y AP 543-04453 - OUTLKLICSAPKOLVD1YAQY2AP
YJD-00999 - CISSTD ALNG LICSAPK OLV NL 1Y AP 2PROC 543-04454 - OUTLKLICSAPKOLVD1YAQY3AP
YJD-01073 - CISSTD ENG SA OLP NL LCLGOV 2PROC QLFD 543-04455 - OUTLKLICSAPKOLVD2YAQY2AP
YJD-01325 - CISSTD LICSAPK D 1Y AQY1 AP 543-04456 - OUTLKLICSAPKOLVD3YAQY1AP
YJD-01327 - CISSTD LICSAPK D 1Y AQY2 AP 543-04457 - OUTLKSAOLVD1YAQY1AP
YJD-01329 - CISSTD LICSAPK D 1Y AQY3 AP 543-04459 - OUTLKSAOLVD1YAQY2AP
YJD-01347 - CISSTD LICSAPK D 2Y AQY2 AP 543-04458 - OUTLKSAOLVD1YAQY3AP
YJD-01357 - CISSTD LICSAPK D 3Y AQY1 AP 543-04460 - OUTLKSAOLVD2YAQY2AP
YJD-01314 - CISSTD LICSAPK LCLGOV W/OSYSCTRSVRLIC 543-04461 - OUTLKSAOLVD3YAQY1AP
YJD-01072 - CISSTD LICSAPK OLP NL LCLGOV 543-04963 - OUTLKSNGLLICSAPKOLVC1YAQY1AP
YJD-01205 - CISSTD LICSAPK OLP NL LCLGOV WO 543-04985 - OUTLKSNGLLICSAPKOLVC1YAQY2AP
YJD-01002 - CISSTD LICSAPK OLV D 1Y AQY1 AP 2PROC 543-05007 - OUTLKSNGLLICSAPKOLVC1YAQY3AP
YJD-01240 - CISSTD LICSAPK OLV D 1Y AQY1 AP WO 543-05031 - OUTLKSNGLLICSAPKOLVC2YAQY2AP
YJD-01006 - CISSTD LICSAPK OLV D 1Y AQY2 AP 2PROC 543-05053 - OUTLKSNGLLICSAPKOLVC3YAQY1AP
YJD-01242 - CISSTD LICSAPK OLV D 1Y AQY2 AP WO 543-04964 - OUTLKSNGLSAOLVC1YAQY1AP
YJD-01010 - CISSTD LICSAPK OLV D 1Y AQY3 AP 2PROC 543-04986 - OUTLKSNGLSAOLVC1YAQY2AP
YJD-01244 - CISSTD LICSAPK OLV D 1Y AQY3 AP WO 543-05008 - OUTLKSNGLSAOLVC1YAQY3AP
YJD-00995 - CISSTD LICSAPK OLV D 2Y AQY2 AP 2PROC 543-05032 - OUTLKSNGLSAOLVC2YAQY2AP
YJD-01258 - CISSTD LICSAPK OLV D 2Y AQY2 AP WO 543-05054 - OUTLKSNGLSAOLVC3YAQY1AP
YJD-01045 - CISSTD LICSAPK OLV D 3Y AQY1 AP 2PROC 77D-00079 - OUTLKWBSNSSCNTCTMGR 2010 32BITX64 BRZLN
YJD-01268 - CISSTD LICSAPK OLV D 3Y AQY1 AP WO 77D-00080 - OUTLKWBSNSSCNTCTMGR 2010 32BITX64 INC
YJD-00929 - CISSTD OLV F 1Y ACDMC AP 2PROC 543-05747 - OUTLOOK 2013 32-BIT/X64 ENGLISH MEDLESS
YJD-01003 - CISSTD SA OLV D 1Y AQY1 AP 2PROC 543-05755 - OUTLOOK 2013 32-BIT/X64 SPANISH MEDALESS
YJD-01007 - CISSTD SA OLV D 1Y AQY2 AP 2PROC 543-02834 - OUTLOOK ALL LNG LIC/SA PK OLV NL 1YR ADD
YJD-01011 - CISSTD SA OLV D 1Y AQY3 AP 2PROC 543-02643 - OUTLOOK ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
YJD-00996 - CISSTD SA OLV D 2Y AQY2 AP 2PROC 543-02647 - OUTLOOK ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
YJD-01046 - CISSTD SA OLV D 3Y AQY1 AP 2PROC 543-02648 - OUTLOOK ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
YJD-01109 - CISSTD SNGL LICSAPK OLP C 2PROC 543-02652 - OUTLOOK ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
YJD-01110 - CISSTD SNGL LICSAPK OLP NL 2PROC QLFD 543-01420 - Outlook For Windows Standard Edition Software Assurance 32-Bit Win License Only
YJD-01111 - CISSTD SNGL SA OLP C 2PROC 543-01496 - Outlook For Windows Standard Edition Software Assurance 32-Bit Win License Only
YJD-01112 - CISSTD SNGL SA OLP NL 2PROC QLFD 543-01427 - Outlook For Windows Standard Edition Software Assurance 32-Bit Win License Only
YJD-00944 - CISSTD SNGL SA OLV C 1Y AQY1 AP 2PROC 543-01502 - Outlook For Windows Standard Edition Software Assurance 32-Bit Win License Only
YJD-00960 - CISSTD SNGL SA OLV C 1Y AQY2 AP 2PROC 543-01392 - Outlook For Windows Standard Edition Software Assurance 32-Bit Win License Only
YJD-00986 - CISSTD SNGL SA OLV C 1Y AQY3 AP 2PROC 36F-00118 - OUTLOOK MAC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE LEVEL C
YJD-00991 - CISSTD SNGL SA OLV C 2Y AQY2 AP 2PROC 36F-00142 - OUTLOOK MAC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE LEVEL D
YJD-01041 - CISSTD SNGL SA OLV C 3Y AQY1 AP 2PROC 36F-00119 - OUTLOOK MAC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE NO LEVE
YJD-00945 - CISSTD SNGL SA OLV NL 1Y AQY1 AP 2PROC 543-02644 - OUTLOOKENGLISHLIC/SAPACKOLVNL1YRACQY2ADD
YJD-00961 - CISSTD SNGL SA OLV NL 1Y AQY2 AP 2PROC 543-02645 - OUTLOOKENGLISHLIC/SAPACKOLVNL1YRACQY3ADD
YJD-00987 - CISSTD SNGL SA OLV NL 1Y AQY3 AP 2PROC 543-02646 - OUTLOOKENGLISHLIC/SAPACKOLVNL2YRACQY2ADD
YJD-00992 - CISSTD SNGL SA OLV NL 2Y AQY2 AP 2PROC 543-02650 - OUTLOOKENGLISHSAOLVNL1YRACQY2ADDTLPROD
YJD-01042 - CISSTD SNGL SA OLV NL 3Y AQY1 AP 2PROC 543-02649 - OUTLOOKENGLISHSAOLVNL1YRACQY3ADDTLPROD
YJD-01297 - CISSTDLICSAPK 1Y AQY1 AP W/OSYSCTRSVRLIC 543-02651 - OUTLOOKENGLISHSAOLVNL2YRACQY2ADDTLPROD
YJD-01305 - CISSTDLICSAPK 1Y AQY2 AP W/OSYSCTRSVRLIC 164-07318 - PBLSHR 2013 ENG OLP NL LCLGOV
YJD-01323 - CISSTDLICSAPK 1Y AQY3 AP W/OSYSCTRSVRLIC 164-07296 - PBLSHR 2013 SNGL OLP C
YJD-01345 - CISSTDLICSAPK 2Y AQY2 AP W/OSYSCTRSVRLIC 164-07297 - PBLSHR 2013 SNGL OLP NL
YJD-01355 - CISSTDLICSAPK 3Y AQY1 AP W/OSYSCTRSVRLIC 164-06102 - PBLSHR ALNG LICSAPK OLV C 1Y AP
YJD-01296 - CISSTDLICSAPK C 1Y AQY1 AP 164-05581 - PBLSHR ALNG LICSAPK OLV D 1Y AP
YJD-01304 - CISSTDLICSAPK C 1Y AQY2 AP 164-05571 - PBLSHRLICSAPKOLVD1YAQY1AP
YJD-01322 - CISSTDLICSAPK C 1Y AQY3 AP 164-05572 - PBLSHRLICSAPKOLVD1YAQY2AP
YJD-01344 - CISSTDLICSAPK C 2Y AQY2 AP 164-05573 - PBLSHRLICSAPKOLVD1YAQY3AP
YJD-01354 - CISSTDLICSAPK C 3Y AQY1 AP 164-05574 - PBLSHRLICSAPKOLVD2YAQY2AP
YJD-01371 - CISSTDLICSAPK OLP C W/OSYSCTRSVRLIC 164-05575 - PBLSHRLICSAPKOLVD3YAQY1AP
YJD-01282 - CISSTDLICSAPK OLP C WO 164-05576 - PBLSHRSAOLVD1YAQY1AP
YJD-01372 - CISSTDLICSAPK OLP NL W/OSYSCTRSVRLIC 164-05578 - PBLSHRSAOLVD1YAQY2AP
YJD-01283 - CISSTDLICSAPK OLP NL WO 164-05577 - PBLSHRSAOLVD1YAQY3AP
YJD-00942 - CISSTDLICSAPK OLV C 1Y AQY1 AP 164-05579 - PBLSHRSAOLVD2YAQY2AP
YJD-01221 - CISSTDLICSAPK OLV C 1Y AQY1 AP WO 164-05580 - PBLSHRSAOLVD3YAQY1AP
YJD-00958 - CISSTDLICSAPK OLV C 1Y AQY2 AP 164-06052 - PBLSHRSNGLLICSAPKOLVC1YAQY1AP
YJD-01229 - CISSTDLICSAPK OLV C 1Y AQY2 AP WO 164-06074 - PBLSHRSNGLLICSAPKOLVC1YAQY2AP
YJD-00984 - CISSTDLICSAPK OLV C 1Y AQY3 AP 164-06096 - PBLSHRSNGLLICSAPKOLVC1YAQY3AP
YJD-01237 - CISSTDLICSAPK OLV C 1Y AQY3 AP WO 164-06120 - PBLSHRSNGLLICSAPKOLVC2YAQY2AP
YJD-00989 - CISSTDLICSAPK OLV C 2Y AQY2 AP 164-06142 - PBLSHRSNGLLICSAPKOLVC3YAQY1AP
YJD-01255 - CISSTDLICSAPK OLV C 2Y AQY2 AP WO 164-06053 - PBLSHRSNGLSAOLVC1YAQY1AP
YJD-01039 - CISSTDLICSAPK OLV C 3Y AQY1 AP 164-06075 - PBLSHRSNGLSAOLVC1YAQY2AP
YJD-01265 - CISSTDLICSAPK OLV C 3Y AQY1 AP WO 164-06097 - PBLSHRSNGLSAOLVC1YAQY3AP
YJD-00943 - CISSTDLICSAPK OLV NL 1Y AQY1 AP 164-06121 - PBLSHRSNGLSAOLVC2YAQY2AP
YJD-01222 - CISSTDLICSAPK OLV NL 1Y AQY1 AP WO 164-06143 - PBLSHRSNGLSAOLVC3YAQY1AP
YJD-00959 - CISSTDLICSAPK OLV NL 1Y AQY2 AP T2Z-00232 - PLYMNTDTCNTR LICSAPK C 3Y AQY1 AP 2PROC
YJD-01230 - CISSTDLICSAPK OLV NL 1Y AQY2 AP WO T2Z-00236 - PLYMNTDTCNTR SA C 3Y AQY1 AP 2PROC
YJD-00985 - CISSTDLICSAPK OLV NL 1Y AQY3 AP T2Z-00237 - PLYMNTDTCNTR SA NL 3Y AQY1 AP 2PROC
YJD-01238 - CISSTDLICSAPK OLV NL 1Y AQY3 AP WO T2Z-00251 - PLYMNTDTCNTR LICSAPK D 3Y AQY1 AP 2PROC
YJD-00990 - CISSTDLICSAPK OLV NL 2Y AQY2 AP T2Z-00233 - PLYMNTDTCNTR LICSAPK NL 3Y AQY1 AP 2PROC
YJD-01256 - CISSTDLICSAPK OLV NL 2Y AQY2 AP WO T2Z-00177 - PLYMNTDTCNTR SA D 2Y AQY2 AP 2PROC
YJD-01040 - CISSTDLICSAPK OLV NL 3Y AQY1 AP T2Z-00253 - PLYMNTDTCNTR SA D 3Y AQY1 AP 2PROC
YJD-01266 - CISSTDLICSAPK OLV NL 3Y AQY1 AP WO T2Z-00234 - PLYMNTDTCNTRC 3Y AQY1 PLYMNTSTD AP 2PROC
J5A-00371 - CNFGMGRCLNTMGMTLCEGLCSAPCKOLPNLLCLGVTPER T2Z-00252 - PLYMNTDTCNTRD 3Y AQY1 PLYMNTSTD AP 2PROC
J5A-00163 - CNFGMGRCLNTMGMTLCEGLCSAPCKOLPNLLCLGVTPER T2Z-00235 - PLYMNTDTCNTRNL 3Y AQY1 PLYMNTSTD AP2PROC
J5A-00370 - CNFGMGRCLNTMGMTLCEGSAOLPNLLCLGVTPERUSER H25-00004 - PocketStreets2004WinCeOnlineDwnld
J5A-00292 - CNFGMGRCLNTMGMTLCSNGLLCSAPCKOLPCPERUSER 079-05835 - POWERPOINT 2013 32-BIT/X64 ENGLISH MDLSS
J5A-00107 - CNFGMGRCLNTMGMTLCSNGLLCSAPCKOLPNLPEROSE 079-02674 - POWERPOINT ALL LNG LIC/SA PK OLV NL 1YR
J5A-00316 - CNFGMGRCLNTMGMTLCSNGLLCSAPCKOLPNLPERUSER 079-02573 - POWERPOINT ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
4EH-00004 - COMFORT MOUSE 4500 FOR BUSINESS ENGLISH,BRAZILIAN,FRENCH,SPANISH AMER/EMEA MULTI 079-02577 - POWERPOINT ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
4HH-00001 - COMPACT OPTL MOUSE 500 FOR BUSINESS USB PORT ENGLISH,BRAZILIAN,FRENCH,SPANISH 1 079-02578 - POWERPOINT ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
J5A-00162 - CONFIGMGRCLNTMGMTLCEGSAOLPNLLCLGVTPEROSE 079-02582 - POWERPOINT ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
J5A-00083 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLPCPEROSE D47-00164 - PowerPoint For MAC Standard Edition Software Assurance MAC License Only NO MEDIA
J5A-00245 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLVNL1YRAC D47-00168 - PowerPoint For MAC Standard Edition Software Assurance MAC License Only NO MEDIA
J5A-00246 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLVNL1YRAC D47-00190 - PowerPoint For MAC Standard Edition Software Assurance MAC License Only NO MEDIA
J5A-00449 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLVNL1YRAC D47-00170 - PowerPoint For MAC Standard Edition Software Assurance MAC License Only NO MEDIA
J5A-00448 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLVNL1YRAC D47-00195 - PowerPoint For MAC Standard Edition Software Assurance MAC License Only NO MEDIA
J5A-00439 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLVNL2YRAC 079-01671 - PowerPoint For Windows Standard Edition Software Assurance 32-Bit Win License On
J5A-00236 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLVNL2YRAC 079-01732 - PowerPoint For Windows Standard Edition Software Assurance 32-Bit Win License On
J5A-00237 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLVNL3YRAC 079-01649 - PowerPoint For Windows Standard Edition Software Assurance 32-Bit Win License On
J5A-00440 - CONFIGMGRCLNTMGMTLCSNGLLCSAPCKOLVNL3YRAC 079-01714 - PowerPoint For Windows Standard Edition Software Assurance 32-Bit Win License On
J5A-00213 - CONFIGMGRCLNTMGMTLCSNGLSAOLVNL1YRACQY1AD 079-01727 - PowerPoint For Windows Standard Edition Software Assurance 32-Bit Win License On
J5A-00416 - CONFIGMGRCLNTMGMTLCSNGLSAOLVNL1YRACQY1PE 079-01636 - PowerPoint For Windows Standard Edition Software Assurance 32-Bit Win License On
J5A-00214 - CONFIGMGRCLNTMGMTLCSNGLSAOLVNL1YRACQY2AD 079-05718 - POWERPOINT MAC 2011 ENGLISH DVD
J5A-00417 - CONFIGMGRCLNTMGMTLCSNGLSAOLVNL1YRACQY2PE D47-00347 - POWERPOINT MAC ALL LNG LIC/SA PK OLV NL
J5A-00228 - CONFIGMGRCLNTMGMTLCSNGLSAOLVNL2YRACQY2AD D47-00328 - POWERPOINT MAC ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
J5A-00431 - CONFIGMGRCLNTMGMTLCSNGLSAOLVNL2YRACQY2PE D47-00326 - POWERPOINT MAC ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
J5A-00229 - CONFIGMGRCLNTMGMTLCSNGLSAOLVNL3YRACQY1AD D47-00331 - POWERPOINT MAC ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
J5A-00432 - CONFIGMGRCLNTMGMTLCSNGLSAOLVNL3YRACQY1PE D47-00333 - POWERPOINT MAC ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
J5A-00078 - CONFIGMGRCLNTMGMTLICSNGLSAOLPCPEROSE 079-02574 - POWERPOINTENGLISHLIC/SAPACKOLVNL1YRACQY2
J5A-00287 - CONFIGMGRCLNTMGMTLICSNGLSAOLPCPERUSER 079-02576 - POWERPOINTENGLISHLIC/SAPACKOLVNL2YRACQY2
J5A-00102 - CONFIGMGRCLNTMGMTLICSNGLSAOLPNLPEROSE 079-02580 - POWERPOINTENGLISHSAOLVNL1YRACQY2ADDTLPRO
J5A-00311 - CONFIGMGRCLNTMGMTLICSNGLSAOLPNLPERUSER 079-02581 - POWERPOINTENGLISHSAOLVNL2YRACQY2ADDTLPRO
J6A-00025 - CONFIGMGRSVRMGMTLCSTDSNGLLCSAPCKOLVNL1YR D47-00329 - POWERPOINTMACENGLISHLIC/SAPACKOLVNL1YRAC
J6A-00041 - CONFIGMGRSVRMGMTLCSTDSNGLSAOLVNL1YRACQY1 D47-00327 - POWERPOINTMACENGLISHLIC/SAPACKOLVNL2YRAC
J3A-00235 - CONFIGMGRSVRSNGLLCSAPCKOLVNL1YRACQY1ADDT D47-00335 - POWERPOINTMACENGLISHSAOLVNL1YRACQY2ADDTL
J3A-00215 - CONFIGMGRSVRSNGLSAOLVNL1YRACQY1ADDTLPROD D47-00332 - POWERPOINTMACENGLISHSAOLVNL2YRACQY2ADDTL
J4A-00228 - CONFIGMGRSVRWSQLSNGLLCSAPCKOLVNL1YRACQY1 H30-04014 - PRCTPRO 2013 OLP NL LCLGOV W1PRCTSRCAL
W06-00790 - CORE CAL ALL LNG LIC/SA PACK OLV NL 1YR ACQ Y1 ENT DEVICE CAL 076-05270 - PRJCT 2013 ENG OLP NL LCLGOV
W06-00854 - CORE CAL ALL LNG LIC/SA PACK OLV NL 1YR ACQ Y1 ENT USER CAL 076-05333 - PRJCT 2013 SNGL OLP C
W06-00852 - CORE CAL ALL LNG LIC/SA PACK OLV NL 3YR ACQ Y1 ENT USER CAL 076-05334 - PRJCT 2013 SNGL OLP NL
W06-00802 - CORE CAL ALL LNG SA OLV NL 1YR ACQ Y1 ENT DEVICE CAL 076-04458 - PRJCT ALNG LICSAPK OLV C 1Y AP
W06-00866 - CORE CAL ALL LNG SA OLV NL 1YR ACQ Y1 ENT USER CAL 076-04355 - PRJCT ALNG LICSAPK OLV D 1Y AP
W06-00924 - CORE CAL ALL LNG SA OLV NL 3YR ACQ Y1 ENT DEVICE CAL 076-04345 - PRJCTLICSAPKOLVD1YAQY1AP
W06-00932 - CORE CAL ALL LNG SA OLV NL 3YR ACQ Y1 ENT USER CAL 076-04346 - PRJCTLICSAPKOLVD1YAQY2AP
W06-00649 - CORE CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL 076-04347 - PRJCTLICSAPKOLVD1YAQY3AP
W06-00654 - CORE CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL 076-04348 - PRJCTLICSAPKOLVD2YAQY2AP
W06-00647 - CORE CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL 076-04349 - PRJCTLICSAPKOLVD3YAQY1AP
W06-00652 - CORE CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL 3PP-00002 - PRJCTLITEOPEN 1MTH AP
W06-00657 - CORE CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL 3PP-00005 - PRJCTLITEOPEN OLV D 1MTH AP
W06-00662 - CORE CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL 3PP-00004-12 - PRJCTLITEOPEN SHRDSVR ALNG D 1MTH AP
W06-00659 - CORE CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL 3PP-00001-12 - PRJCTLITEOPEN SHRDSVR ALNG NL 1MTH AP
W06-00664 - CORE CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL 3PP-00003 - PRJCTLITEOPEN SHRDSVR SNGL SUBSVL OLP NL
W06-00015 - Core CAL For Windows Device Client Access License Software Assurance WinNT/2K 1 3PP-00007 - PRJCTLITEOPEN SUBSVL OLP NL ANNUAL
W06-00007 - Core CAL For Windows Device Client Access License Software Assurance WinNT/2K 1 S5Z-00007 - PRJCTONLNOPEN LCLGOV QLFD
W06-00008 - Core CAL For Windows Device Client Access License Software Assurance WinNT/2K 1 S5Z-00004-12 - PRJCTONLNOPEN D 1MTH AP
W06-00013 - Core CAL For Windows Device Client Access License Software Assurance WinNT/2K 2 S5Z-00001-12 - PRJCTONLNOPEN NL 1MTH AP
W06-00005 - Core CAL For Windows Device Client Access License Software Assurance WinNT/2K 2 S5Z-00003 - PRJCTONLNOPEN SHRDSVR QLFD
W06-00004 - Core CAL For Windows Device Client Access License Software Assurance WinNT/2K 2 S5Z-00005 - PRJCTONLNOPEN SHRDSVR SUBSVL D 1MTH AP
W06-01488 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P S5Z-00002 - PRJCTONLNOPEN SHRDSVR SUBSVL NL 1MTH AP
W06-01494 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-04072 - PRJCTPRO 2013 SNGL OLP C W1PRJCTSVRCAL
W06-01496 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-04073 - PRJCTPRO 2013 SNGL OLP NL W1PRJCTSVRCAL
W06-01530 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-02585 - PRJCTPRO ALNG LICSAPK OLV C 1Y AP W1PRJC
W06-01532 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-02389 - PRJCTPRO ALNG LICSAPK OLV D 1Y AP W1PRJC
W06-01542 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-02648 - PRJCTPRO ALNG SASU OLV C 1Y PRJCTSTD AP W1PRJCTSVRCAL
W06-01470 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-02650 - PRJCTPRO ALNG SASU OLV D 1Y PRJCTSTD AP W1PRJCTSVRCAL
W06-01472 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-02649 - PRJCTPRO ALNG SASU OLV NL 1Y PRJCTSTD AP W1PRJCTSVRCAL
W06-01504 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-04150 - PRJCTPRO OLV C 1Y AP PROMO W1PRJCTSVRCAL
W06-01486 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-04185 - PRJCTPRO OLV D 1Y AP PROMO W1PRJCTSVRCAL
W06-01544 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-04165 - PRJCTPRO OLV D 1YAQY1AP PRMO W1PRCTSRCAL
W06-01502 - CORE CALCLIENT ACCESS LIC ALL LNG L/SA P H30-04169 - PRJCTPRO OLV D 1YAQY2AP PRMO W1PRCTSRCAL
W06-00793 - CORE CALCLIENT ACCESS LIC ALL LNG LIC/SA H30-04280 - PRJCTPRO OLV D 3YAQY1AP PRMO W1PRCTSRCAL
W06-00794 - CORE CALCLIENT ACCESS LIC ALL LNG LIC/SA H30-04173 - PRJCTPRO OLV D1Y AQY3APPRMO W1PRCTSRCAL
W06-00857 - CORE CALCLIENT ACCESS LIC ALL LNG LIC/SA H30-04151 - PRJCTPRO OLV NL 1YAP PROMO W1PRJCTSVRCAL
W06-00858 - CORE CALCLIENT ACCESS LIC ALL LNG LIC/SA S2Z-00004-12 - PRJCTPROFORO365OPEN D 1MTH AP
W06-01592 - CORE CALCLIENT ACCESS LIC ALL LNG LSA PA S2Z-00007 - PRJCTPROFORO365OPEN LCLGOV QLFD
W06-01568 - CORE CALCLIENT ACCESS LIC ALL LNG OLV NL S2Z-00001-12 - PRJCTPROFORO365OPEN NL 1MTH AP
W06-01474 - CORE CALCLIENT ACCESS LIC ALL LNG SA OLV S2Z-00003 - PRJCTPROFORO365OPENQLFD
W06-01476 - CORE CALCLIENT ACCESS LIC ALL LNG SA OLV S2Z-00002 - PRJCTPROFORO365OPENSUBSVL NL 1MTH AP
W06-01548 - CORE CALCLIENT ACCESS LIC ALL LNG SA OLV H30-02374 - PRJCTPROLICSAPKOLVD1YAQY1APW1PRJC
W06-01546 - CORE CALCLIENT ACCESS LIC ALL LNG SA OLV H30-02375 - PRJCTPROLICSAPKOLVD1YAQY2APW1PRJC
W06-01594 - CORE CALCLIENT ACCESS LIC ALLLNG LSA PAC H30-02376 - PRJCTPROLICSAPKOLVD1YAQY3APW1PRJC
W06-00801 - CORECAL ALNG LICSAPK OLV C 1Y ENT DVCCAL H30-02377 - PRJCTPROLICSAPKOLVD2YAQY2APW1PRJC
W06-00865 - CORECAL ALNG LICSAPK OLV C 1Y ENT USRCAL H30-02378 - PRJCTPROLICSAPKOLVD3YAQY1APW1PRJC
W06-01501 - CORECAL ALNG LICSAPK OLV C 1Y PLTFRM DVC H30-04222 - PRJCTPROLV C2Y AQY2 AP PROMO W1PRCTSRCAL
W06-01503 - CORECAL ALNG LICSAPK OLV C 1Y PLTFRM USR H30-04139 - PRJCTPROLV NL1YAQY3 AP PROMO W1PRCTSRCAL
W06-01591 - CORECAL ALNG LICSAPK OLV C 1Y PLTFRMUTD H30-04138 - PRJCTPROOLV C 1Y AQY3 AP PRMO W1PRTSRCAL
W06-01593 - CORECAL ALNG LICSAPK OLV C 1Y PLTFRMUTD H30-04197 - PRJCTPROOLV C 1YAQY2AP PROMO W1PRCTSRCAL
W06-01027 - CORECAL ALNG LICSAPK OLV C 1Y UTD DVCCAL H30-04267 - PRJCTPROOLV C3YAQY1 AP PROMO W1PRCTSRCAL
W06-01028 - CORECAL ALNG LICSAPK OLV C 1Y UTD USRCAL H30-04122 - PRJCTPROOLV NL 1YAQY1AP PRMO W1PRCTSRCAL
W06-01123 - CORECAL ALNG LICSAPK OLV D 1Y ENT DVCCAL H30-04223 - PRJCTPROOLV NL 2Y AQY2 APPRMO W1PRTSRCAL
W06-01141 - CORECAL ALNG LICSAPK OLV D 1Y ENT USRCAL H30-04198 - PRJCTPROOLV NL1YAQY2APPROMO W1PRCTSRCAL
W06-01525 - CORECAL ALNG LICSAPK OLV D 1Y PLTFRM DVC H30-04268 - PRJCTPROOLV NL3Y AQY1AP PRMO W1PRCTSRCAL
W06-01526 - CORECAL ALNG LICSAPK OLV D 1Y PLTFRM USR H30-02384 - PRJCTPROSAOLVD1YAQY1APW1PRJCTSVRC
W06-01601 - CORECAL ALNG LICSAPK OLV D 1Y PLTFRMUTD H30-02386 - PRJCTPROSAOLVD1YAQY2APW1PRJCTSVRC
W06-01600 - CORECAL ALNG LICSAPK OLV D 1Y PLTFRMUTD H30-02385 - PRJCTPROSAOLVD1YAQY3APW1PRJCTSVRC
W06-01124 - CORECAL ALNG LICSAPK OLV D 1Y UTD DVCCAL H30-02387 - PRJCTPROSAOLVD2YAQY2APW1PRJCTSVRC
W06-01142 - CORECAL ALNG LICSAPK OLV D 1Y UTD USRCAL H30-02388 - PRJCTPROSAOLVD3YAQY1APW1PRJCTSVRC
W06-00798 - CORECALALNGLICSAPKOLVC1YAQY1ENTD H30-02380 - PRJCTPROSASUOLVD1YAQY2PRJCTSTDAP
W06-00862 - CORECALALNGLICSAPKOLVC1YAQY1ENTU H30-02381 - PRJCTPROSASUOLVD1YAQY3PRJCTSTDAP
W06-01471 - CORECALALNGLICSAPKOLVC1YAQY1PLTFR H30-02382 - PRJCTPROSASUOLVD2YAQY2PRJCTSTDAP
W06-01469 - CORECALALNGLICSAPKOLVC1YAQY1PLTFR H30-02383 - PRJCTPROSASUOLVD3YAQY1PRJCTSTDAP
W06-00799 - CORECALALNGLICSAPKOLVC1YAQY2ENTD H30-02537 - PRJCTPROSNGLLICSAPKOLVC1YAQY1APW
W06-00863 - CORECALALNGLICSAPKOLVC1YAQY2ENTU H30-02558 - PRJCTPROSNGLLICSAPKOLVC1YAQY2APW
W06-01487 - CORECALALNGLICSAPKOLVC1YAQY2PLTFR H30-02579 - PRJCTPROSNGLLICSAPKOLVC1YAQY3APW
W06-01485 - CORECALALNGLICSAPKOLVC1YAQY2PLTFR H30-02601 - PRJCTPROSNGLLICSAPKOLVC2YAQY2APW
W06-00800 - CORECALALNGLICSAPKOLVC1YAQY3ENTD H30-02622 - PRJCTPROSNGLLICSAPKOLVC3YAQY1APW
W06-00864 - CORECALALNGLICSAPKOLVC1YAQY3ENTU H30-02539 - PRJCTPROSNGLSAOLVC1YAQY1APW1PRJC
W06-01495 - CORECALALNGLICSAPKOLVC1YAQY3PLTFR H30-02560 - PRJCTPROSNGLSAOLVC1YAQY2APW1PRJC
W06-01493 - CORECALALNGLICSAPKOLVC1YAQY3PLTFR H30-02581 - PRJCTPROSNGLSAOLVC1YAQY3APW1PRJC
W06-00797 - CORECALALNGLICSAPKOLVC2YAQY2ENTD H30-02603 - PRJCTPROSNGLSAOLVC2YAQY2APW1PRJC
W06-00861 - CORECALALNGLICSAPKOLVC2YAQY2ENTU H30-02624 - PRJCTPROSNGLSAOLVC3YAQY1APW1PRJC
W06-01531 - CORECALALNGLICSAPKOLVC2YAQY2PLTFR H30-02538 - PRJCTPROSNGLSASUOLVC1YAQY1PRJCTST
W06-01529 - CORECALALNGLICSAPKOLVC2YAQY2PLTFR H30-02559 - PRJCTPROSNGLSASUOLVC1YAQY2PRJCTST
W06-00796 - CORECALALNGLICSAPKOLVC3YAQY1ENTD H30-02580 - PRJCTPROSNGLSASUOLVC1YAQY3PRJCTST
W06-00860 - CORECALALNGLICSAPKOLVC3YAQY1ENTU H30-02602 - PRJCTPROSNGLSASUOLVC2YAQY2PRJCTST
W06-01541 - CORECALALNGLICSAPKOLVC3YAQY1PLTFR H30-02623 - PRJCTPROSNGLSASUOLVC3YAQY1PRJCTST
W06-01543 - CORECALALNGLICSAPKOLVC3YAQY1PLTFR 076-04350 - PRJCTSAOLVD1YAQY1AP
W06-01120 - CORECALALNGLICSAPKOLVD1YAQY1ENTD 076-04352 - PRJCTSAOLVD1YAQY2AP
W06-01138 - CORECALALNGLICSAPKOLVD1YAQY1ENTU 076-04351 - PRJCTSAOLVD1YAQY3AP
W06-01510 - CORECALALNGLICSAPKOLVD1YAQY1PLTFR 076-04353 - PRJCTSAOLVD2YAQY2AP
W06-01509 - CORECALALNGLICSAPKOLVD1YAQY1PLTFR 076-04354 - PRJCTSAOLVD3YAQY1AP
W06-01121 - CORECALALNGLICSAPKOLVD1YAQY2ENTD 076-04426 - PRJCTSNGLLICSAPKOLVC1YAQY1AP
W06-01139 - CORECALALNGLICSAPKOLVD1YAQY2ENTU 076-04440 - PRJCTSNGLLICSAPKOLVC1YAQY2AP
W06-01518 - CORECALALNGLICSAPKOLVD1YAQY2PLTFR 076-04454 - PRJCTSNGLLICSAPKOLVC1YAQY3AP
W06-01517 - CORECALALNGLICSAPKOLVD1YAQY2PLTFR 076-04469 - PRJCTSNGLLICSAPKOLVC2YAQY2AP
W06-01122 - CORECALALNGLICSAPKOLVD1YAQY3ENTD 076-04483 - PRJCTSNGLLICSAPKOLVC3YAQY1AP
W06-01140 - CORECALALNGLICSAPKOLVD1YAQY3ENTU 076-04427 - PRJCTSNGLSAOLVC1YAQY1AP
W06-01522 - CORECALALNGLICSAPKOLVD1YAQY3PLTFR 076-04441 - PRJCTSNGLSAOLVC1YAQY2AP
W06-01521 - CORECALALNGLICSAPKOLVD1YAQY3PLTFR 076-04455 - PRJCTSNGLSAOLVC1YAQY3AP
W06-01119 - CORECALALNGLICSAPKOLVD2YAQY2ENTD 076-04470 - PRJCTSNGLSAOLVC2YAQY2AP
W06-01137 - CORECALALNGLICSAPKOLVD2YAQY2ENTU 076-04484 - PRJCTSNGLSAOLVC3YAQY1AP
W06-01538 - CORECALALNGLICSAPKOLVD2YAQY2PLTFR H22-02524 - PRJCTSVR 2013 ENG OLP NL LCLGOV
W06-01537 - CORECALALNGLICSAPKOLVD2YAQY2PLTFR H22-02464 - PRJCTSVR 2013 SNGL OLP C
W06-01118 - CORECALALNGLICSAPKOLVD3YAQY1ENTD H22-02465 - PRJCTSVR 2013 SNGL OLP NL
W06-01136 - CORECALALNGLICSAPKOLVD3YAQY1ENTU H22-02148 - PRJCTSVR ALNG LICSAPK OLV C 1Y AP
W06-01558 - CORECALALNGLICSAPKOLVD3YAQY1PLTFR H22-01843 - PRJCTSVR ALNG LICSAPK OLV D 1Y AP
W06-01557 - CORECALALNGLICSAPKOLVD3YAQY1PLTFR H21-03278 - PRJCTSVRCAL 2013 OLP NL LCLGOV DVCCAL
W06-00859 - CORECALALNGSAOLVC1YAQY1ENTUSRCAL H21-03279 - PRJCTSVRCAL 2013 OLP NL LCLGV USRCAL
W06-01473 - CORECALALNGSAOLVC1YAQY1PLTFRMDVC H21-03303 - PRJCTSVRCAL 2013 SNGL OLP C DVCCAL
W06-01475 - CORECALALNGSAOLVC1YAQY1PLTFRMUSR H21-03305 - PRJCTSVRCAL 2013 SNGL OLP C USRCAL
W06-00923 - CORECALALNGSAOLVC3YAQY1ENTDVCCAL H21-03304 - PRJCTSVRCAL 2013 SNGL OLP NL DVCCAL
W06-00931 - CORECALALNGSAOLVC3YAQY1ENTUSRCAL H21-03306 - PRJCTSVRCAL 2013 SNGL OLP NL USRCAL
W06-01545 - CORECALALNGSAOLVC3YAQY1PLTFRMDVC H21-00419 - PRJCTSVRCAL ALNG LICSAPK MVL DVCCAL
W06-01547 - CORECALALNGSAOLVC3YAQY1PLTFRMUSR H21-02906 - PRJCTSVRCAL ALNG LICSAPK OLV C 1Y AP DVC
W06-01125 - CORECALALNGSAOLVD1YAQY1ENTDVCCAL H21-02907 - PRJCTSVRCAL ALNG LICSAPK OLV C 1Y AP USR
W06-01143 - CORECALALNGSAOLVD1YAQY1ENTUSRCAL H21-02688 - PRJCTSVRCAL ALNG LICSAPK OLV D 1Y AP DVC
W06-01511 - CORECALALNGSAOLVD1YAQY1PLTFRMDVC H21-02691 - PRJCTSVRCAL ALNG LICSAPK OLV D 1Y AP USR
W06-01512 - CORECALALNGSAOLVD1YAQY1PLTFRMUSR H21-02669 - PRJCTSVRCALLICSAPKOLVD1YAQY2APDVC
W06-01153 - CORECALALNGSAOLVD3YAQY1ENTDVCCAL H21-02672 - PRJCTSVRCALLICSAPKOLVD1YAQY2APUSR
W06-01155 - CORECALALNGSAOLVD3YAQY1ENTUSRCAL H21-02670 - PRJCTSVRCALLICSAPKOLVD1YAQY3APDVC
W06-01559 - CORECALALNGSAOLVD3YAQY1PLTFRMDVC H21-02673 - PRJCTSVRCALLICSAPKOLVD1YAQY3APUSR
W06-01560 - CORECALALNGSAOLVD3YAQY1PLTFRMUSR H21-02674 - PRJCTSVRCALLICSAPKOLVD2YAQY2APDVC
W06-00648 - CORECALCLIENTACCESSLICENGLISHLIC/SAOLVNL H21-02675 - PRJCTSVRCALLICSAPKOLVD2YAQY2APUSR
W06-00650 - CORECALCLIENTACCESSLICENGLISHLIC/SAOLVNL H21-02676 - PRJCTSVRCALLICSAPKOLVD3YAQY1APDVC
W06-00653 - CORECALCLIENTACCESSLICENGLISHLIC/SAOLVNL H21-02677 - PRJCTSVRCALLICSAPKOLVD3YAQY1APUSR
W06-00656 - CORECALCLIENTACCESSLICENGLISHLIC/SAOLVNL H21-02680 - PRJCTSVRCALSAOLVD1YAQY2APDVCCAL
W06-00655 - CORECALCLIENTACCESSLICENGLISHLIC/SAOLVNL H21-02683 - PRJCTSVRCALSAOLVD1YAQY2APUSRCAL
W06-00661 - CORECALCLIENTACCESSLICENGLISHSAOLVNL1YRA H21-02679 - PRJCTSVRCALSAOLVD1YAQY3APDVCCAL
W06-00666 - CORECALCLIENTACCESSLICENGLISHSAOLVNL1YRA H21-02682 - PRJCTSVRCALSAOLVD1YAQY3APUSRCAL
W06-00663 - CORECALCLIENTACCESSLICENGLISHSAOLVNL2YRA H21-02684 - PRJCTSVRCALSAOLVD2YAQY2APDVCCAL
W06-00658 - CORECALCLIENTACCESSLICENGLISHSAOLVNL2YRA H21-02685 - PRJCTSVRCALSAOLVD2YAQY2APUSRCAL
W06-01099 - CORECALLICSAPKOLVD1YAQY1APDVCCAL H21-02686 - PRJCTSVRCALSAOLVD3YAQY1APDVCCAL
W06-01104 - CORECALLICSAPKOLVD1YAQY1APUSRCAL H21-02687 - PRJCTSVRCALSAOLVD3YAQY1APUSRCAL
W06-01100 - CORECALLICSAPKOLVD1YAQY2APDVCCAL H21-02842 - PRJCTSVRCALSNGLLICSAPKOLVC1YAQY1A
W06-01105 - CORECALLICSAPKOLVD1YAQY2APUSRCAL H21-02843 - PRJCTSVRCALSNGLLICSAPKOLVC1YAQY1A
W06-01101 - CORECALLICSAPKOLVD1YAQY3APDVCCAL H21-02871 - PRJCTSVRCALSNGLLICSAPKOLVC1YAQY2A
W06-01106 - CORECALLICSAPKOLVD1YAQY3APUSRCAL H21-02870 - PRJCTSVRCALSNGLLICSAPKOLVC1YAQY2A
W06-01098 - CORECALLICSAPKOLVD2YAQY2APDVCCAL H21-02898 - PRJCTSVRCALSNGLLICSAPKOLVC1YAQY3A
W06-01103 - CORECALLICSAPKOLVD2YAQY2APUSRCAL H21-02899 - PRJCTSVRCALSNGLLICSAPKOLVC1YAQY3A
W06-01097 - CORECALLICSAPKOLVD3YAQY1APDVCCAL H21-02928 - PRJCTSVRCALSNGLLICSAPKOLVC2YAQY2A
W06-01102 - CORECALLICSAPKOLVD3YAQY1APUSRCAL H21-02929 - PRJCTSVRCALSNGLLICSAPKOLVC2YAQY2A
W06-01111 - CORECALSAOLVD1YAQY2APDVCCAL H21-02957 - PRJCTSVRCALSNGLLICSAPKOLVC3YAQY1A
W06-01116 - CORECALSAOLVD1YAQY2APUSRCAL H21-02956 - PRJCTSVRCALSNGLLICSAPKOLVC3YAQY1A
W06-01110 - CORECALSAOLVD1YAQY3APDVCCAL H21-02844 - PRJCTSVRCALSNGLSAOLVC1YAQY1APDVC
W06-01115 - CORECALSAOLVD1YAQY3APUSRCAL H21-02845 - PRJCTSVRCALSNGLSAOLVC1YAQY1APUSR
W06-01108 - CORECALSAOLVD2YAQY2APDVCCAL H21-02872 - PRJCTSVRCALSNGLSAOLVC1YAQY2APDVC
W06-01113 - CORECALSAOLVD2YAQY2APUSRCAL H21-02873 - PRJCTSVRCALSNGLSAOLVC1YAQY2APUSR
W06-01109 - CORECALSAOLVD3YAQY1APDVCCAL H21-02900 - PRJCTSVRCALSNGLSAOLVC1YAQY3APDVC
W06-01114 - CORECALSAOLVD3YAQY1APUSRCAL H21-02901 - PRJCTSVRCALSNGLSAOLVC1YAQY3APUSR
H5T-00007 - CRTFCTNACDMCVL FEE OLV E EACH ACDMC AP H21-02930 - PRJCTSVRCALSNGLSAOLVC2YAQY2APDVC
H5T-00004 - CRTFCTNACDMCVL FEE OLV E EACH ACDMC AP H21-02931 - PRJCTSVRCALSNGLSAOLVC2YAQY2APUSR
H5T-00005 - CRTFCTNACDMCVL FEE OLV F EACH ACDMC AP H21-02958 - PRJCTSVRCALSNGLSAOLVC3YAQY1APDVC
H5T-00008 - CRTFCTNACDMCVL FEE OLV F EACH ACDMC AP H21-02959 - PRJCTSVRCALSNGLSAOLVC3YAQY1APUSR
T6L-00282 - CTRDATACTR SASU OLV C 1Y CTRSTD 2PROC H22-01834 - PRJCTSVRLICSAPKOLVD1YAQY2AP
T6L-00290 - CTRDATACTR SASU OLV D 1Y CTRSTD 2PROC H22-01835 - PRJCTSVRLICSAPKOLVD1YAQY3AP
T2Z-00058 - D 1Y AQY1 VSDPLYMNTSTD AP 2PROC H22-01836 - PRJCTSVRLICSAPKOLVD2YAQY2AP
T2Z-00074 - D 1Y AQY2 VSDPLYMNTSTD AP 2PROC H22-01837 - PRJCTSVRLICSAPKOLVD3YAQY1AP
T2Z-00080 - D 1Y AQY3 VSDPLYMNTSTD AP 2PROC H22-01840 - PRJCTSVRSAOLVD1YAQY2AP
T2Z-00176 - D 2Y AQY2 VSDPLYMNTSTD AP 2PROC H22-01839 - PRJCTSVRSAOLVD1YAQY3AP
CVA-00079 - DATAPROTECTSTDMGMTLCSNGLLCSAPCKOLVNL1YRA H22-01841 - PRJCTSVRSAOLVD2YAQY2AP
CVA-00070 - DATAPROTECTSTDMGMTLCSNGLSAOLVNL1YRACQY1P H22-01842 - PRJCTSVRSAOLVD3YAQY1AP
CGA-00075 - DATAPRTCTNENTMGMTLCSNGLLCSAPCKOLVNL1YRAC H22-02116 - PRJCTSVRSNGLLICSAPKOLVC1YAQY1AP
CGA-00090 - DATAPRTCTNENTMGMTLCSNGLSAOLVNL1YRACQY1AD H22-02130 - PRJCTSVRSNGLLICSAPKOLVC1YAQY2AP
AAA-01790 - DESIGN, WORK TOGETHER AND PRESENT EASILY WITH INTUITIVE FEATURES AND PROFESSIONA H22-02144 - PRJCTSVRSNGLLICSAPKOLVC1YAQY3AP
AAA-01872 - DESIGN, WORK TOGETHER AND PRESENT EASILY WITH INTUITIVE FEATURES AND PROFESSIONA H22-02159 - PRJCTSVRSNGLLICSAPKOLVC2YAQY2AP
B6K-00004 - DESKTOP SMALL BUSINESS ALL LNG LIC/SA PACK OLV NL 1YR ACQ Y1 ENT H22-02173 - PRJCTSVRSNGLLICSAPKOLVC3YAQY1AP
B6K-00016 - DESKTOP SMALL BUSINESS ALL LNG SA OLV NL 1YR ACQ Y1 ENT H22-02117 - PRJCTSVRSNGLSAOLVC1YAQY1AP
B6K-00016 - DESKTOP SMALL BUSINESS ALL LNG SA OLV NL 1YR ACQ Y1 ENT H22-02131 - PRJCTSVRSNGLSAOLVC1YAQY2AP
DR2-00001 - DR2-00001-12 H22-02145 - PRJCTSVRSNGLSAOLVC1YAQY3AP
DS2-00001 - DS2-00001-12 H22-02160 - PRJCTSVRSNGLSAOLVC2YAQY2AP
DS2-00002 - DS2-00002-12 H22-02174 - PRJCTSVRSNGLSAOLVC3YAQY1AP
WSB-00374 - DSKTP OLV F 1MTH ACDMC PERDVC FORWINSA H30-04240 - PRJTPRO OLV D 2YAQY2 AP PRMO W1PRTSRCAL
WSB-00374 - DSKTP OLV F 1MTH ACDMC PERDVC FORWINSA H30-04121 - PRJTPROOLV C 1Y AQY1 AP PROMOW1PRCTSRCAL
WSB-00073 - DSKTP OPTIMIZATION PCK SA ENGLISH MNTHLYSUB OLVNL 1M ADDPRD FOR 77D-00045 - PRODSKTPWMDOP ALNG LICSAPK OLV C 1Y AQY1
WSB-00073 - DSKTP OPTIMIZATION PCK SA ENGLISH MONTHLY SUBSCRIPTION OLV NL 1M ADDTL PROD FOR 77D-00046 - PRODSKTPWMDOP ALNG LICSAPK OLV C 1Y AQY2
A07-00208 - DSKTP PRO ALL LNG LIC/SA PACK OLV NL 1YR ACQ Y1 ENT 77D-00047 - PRODSKTPWMDOP ALNG LICSAPK OLV C 1Y AQY3
A07-00208 - DSKTP PRO ALL LNG LIC/SA PACK OLV NL 1YR ACQ Y1 ENT 77D-00048 - PRODSKTPWMDOP ALNG LICSAPK OLV C 2Y AQY2
A07-00220 - DSKTP PRO ALL LNG SA OLV NL 1YR ACQ Y1 ENT 77D-00049 - PRODSKTPWMDOP ALNG LICSAPK OLV C 3Y AQY1
WSB-00089 - DSKTPOPTIMIZATIONPCKSAALLLNGMONSUBOLVNL1 076-05068 - PROJECT 2013 32-BIT/X64 ENGLISH MDIALESS
WSB-00089 - DSKTPOPTIMIZATIONPCKSAALLLNGMONSUBOLVNL1 076-03609 - PROJECT ALL LNG LIC/SA PK OLV NL 1YR ADD
WSB-00079 - DSKTPOPTMZTNPKFORSA ALNG SUBSVL OLV D 1M 076-03395 - PROJECT ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
WSB-00074 - DSKTPOPTMZTNPKFORSA ALNG SUBSVL OLV NL 1MTH AP PERDVC FORWINSA 076-03399 - PROJECT ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
WSB-00093 - DSKTPOPTMZTNPKFORSAALNGSUBSVLOLVD1M 076-03400 - PROJECT ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
WSB-00093 - DSKTPOPTMZTNPKFORSAALNGSUBSVLOLVD1M 076-03404 - PROJECT ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
WSB-00078 - DSKTPOPTMZTNPKFORSASUBSVLOLVD1MTHAP H30-00090 - Project For Windows Professional Software Assurance 32-Bit Win License Only NO M
WSB-00078 - DSKTPOPTMZTNPKFORSASUBSVLOLVD1MTHAP H30-00147 - Project For Windows Professional Software Assurance 32-Bit Win License Only NO M
WSB-00217 - DSKTPOPTMZTNPKSASBSVLOLVC 1MTHAP1DVCWNSA H30-00104 - Project For Windows Professional Software Assurance 32-Bit Win License Only NO M
WSB-00217 - DSKTPOPTMZTNPKSASBSVLOLVC 1MTHAP1DVCWNSA H30-00141 - Project For Windows Professional Software Assurance 32-Bit Win License Only NO M
WSB-00217 - DSKTPOPTMZTNPKSASBSVLOLVC 1MTHAP1DVCWNSA 076-01787 - Project For Windows Standard Edition Software Assurance 32-Bit Win License Only
DT2-00001 - DT2-00001-12 076-02002 - Project For Windows Standard Edition Software Assurance 32-Bit Win License Only
DU2-00001 - DU2-00001-12 076-01866 - Project For Windows Standard Edition Software Assurance 32-Bit Win License Only
DU2-00002 - DU2-00002-12 076-01941 - Project For Windows Standard Edition Software Assurance 32-Bit Win License Only
JS5-00098 - DUETMSOFFICESAPSVRENGLISHLIC/SAPACKOLVNL H30-03673 - PROJECT PRO 2013 32-BIT/X64 ENGLSH MDLSS
DV2-00001 - DV2-00001-12 H30-01671 - PROJECT PRO ALL LNG LIC/SA PK OLV NL 1YR
DV2-00002 - DV2-00002-12 H30-01386 - PROJECT PRO ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD W/1 PROJECTSVR CAL
DW2-00001 - DW2-00001-12 H30-01390 - PROJECT PRO ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD W/1 PROJECTSVR CAL
DW2-00002 - DW2-00002-12 H30-01396 - PROJECT PRO ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD W/1 PROJECTSVR CAL
DX2-00001 - DX2-00001-12 H30-01400 - PROJECT PRO ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD W/1 PROJECTSVR CAL
DX2-00002 - DX2-00002-12 H30-01391 - PROJECT PRO ENGLISH SA STEP UP OLV NL 1YR ACQ Y1 ADDTL PROD W/1 PROJECTSVR CAL
QYA-00012 - DYN CRM ADDITVE CAL ALL LNG LIC/SA PK OL H30-01395 - PROJECT PRO ENGLISH SA STEP UP OLV NL 3YR ACQ Y1 ADDTL PROD W/1 PROJECTSVR CAL
QYA-00046 - DYN CRM ADDITVE CAL ALL LNG LIC/SA PK OL H22-01460 - PROJECT SERVER ALL LNG LIC/SA PK OLV NL
ZFA-00409 - DYN CRM CAL ALL LNG LIC/SA PK OLV NL 1YR H21-02115 - PROJECT SERVER CAL ALL LNG LIC/SA PK OLV
ZFA-00447 - DYN CRM CAL ALL LNG LIC/SA PK OLV NL 1YR H21-02129 - PROJECT SERVER CAL ALL LNG LIC/SA PK OLV
ZGA-00228 - DYN CRM EXTRNL CON ALL LNG LIC/SA PK OLV H21-01755 - PROJECT SERVER CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL
QZA-00254 - DYN CRM LTD CAL ALL LNG LIC/SA PK OLV NL H21-01758 - PROJECT SERVER CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL
QZA-00015 - DYN CRM LTD CAL ALL LNG LIC/SA PK OLV NL H21-01763 - PROJECT SERVER CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL
QAA-00083 - DYN CRM WKGRP SVR ALL LNG LIC/SA PK OLV H21-01764 - PROJECT SERVER CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL
ZFA-00109 - DYNAMICS CRM CAL SNGL LIC/SA PACK OLP NL USER CAL QUALIFIED H21-01765 - PROJECT SERVER CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL
3CJ-00581 - DYNAMICS CRM ESS CAL ALL LNG LICENSE H21-01768 - PROJECT SERVER CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL
3CJ-00056 - DYNAMICS CRM ESS CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENS H21-01773 - PROJECT SERVER CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL
3CJ-00055 - DYNAMICS CRM ESS CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENS H21-01774 - PROJECT SERVER CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL
3CJ-00102 - DYNAMICS CRM ESS CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENS H22-01279 - PROJECT SERVER ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
3CJ-00057 - DYNAMICS CRM ESS CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENS H22-01283 - PROJECT SERVER ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
3CJ-00101 - DYNAMICS CRM ESS CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENS H22-01284 - PROJECT SERVER ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
3CJ-00058 - DYNAMICS CRM ESS CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENS H22-01288 - PROJECT SERVER ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
3EJ-01252 - DYNAMICS CRM LIMITED USE ADD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA H21-00303 - Project Server For Windows Device Client Access License Software Assurance 32-Bi
3EJ-01126 - DYNAMICS CRM LIMITED USE ADD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA H21-00165 - Project Server For Windows Device Client Access License Software Assurance 32-Bi
3EJ-01127 - DYNAMICS CRM LIMITED USE ADD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA H21-00194 - Project Server For Windows Device Client Access License Software Assurance 32-Bi
3EJ-01253 - DYNAMICS CRM LIMITED USE ADD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA H21-00252 - Project Server For Windows Device Client Access License Software Assurance 32-Bi
3EJ-01255 - DYNAMICS CRM LIMITED USE ADD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA H21-00348 - Project Server For Windows Device Client Access License Software Assurance 32-Bi
3EJ-01254 - DYNAMICS CRM LIMITED USE ADD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA H30-00123 - Project Server For Windows Professional Software Assurance 32-Bit Win License On
N9J-00510 - DYNAMICS CRM SVR ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE LE H30-00174 - Project Server For Windows Professional Software Assurance 32-Bit Win License On
N9J-00130 - DYNAMICS CRM SVR ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE LE H22-00301 - Project Server For Windows Server Software Assurance 32-Bit Win License Only NO
N9J-00534 - DYNAMICS CRM SVR ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE LE H22-00347 - Project Server For Windows Server Software Assurance 32-Bit Win License Only NO
N9J-00096 - DYNAMICS CRM SVR ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE LE 076-01848 - Project Server For Windows Standard Edition Software Assurance 32-Bit Win Licens
N9J-00511 - DYNAMICS CRM SVR ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE NO 076-02020 - Project Server For Windows Standard Edition Software Assurance 32-Bit Win Licens
N9J-00107 - DYNAMICS CRM SVR ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICENSE NO H22-00177 - Project Server For Windows Standard Software Assurance 32-Bit Win License Only N
N9J-00738 - DYNAMICS CRM SVR ALL LNG SA STEP UP OPEN VALUE 1 LICENSE LEVEL C DYNAMICS CRM WK H22-00133 - Project Server For Windows Standard Software Assurance 32-Bit Win License Only N
N9J-00746 - DYNAMICS CRM SVR ALL LNG SA STEP UP OPEN VALUE 1 LICENSE LEVEL D DYNAMICS CRM WK H22-00270 - Project Server For Windows Standard Software Assurance 32-Bit Win License Only N
N9J-00739 - DYNAMICS CRM SVR ALL LNG SA STEP UP OPEN VALUE 1 LICENSE NO LEVEL DYNAMICS CRM W H22-00316 - Project Server For Windows Standard Software Assurance 32-Bit Win License Only N
ZFA-00065 - DYNAMICSCRMCALSNGLLIC/SAPACKOLPCUSERCAL H21-00542 - Project Server For Windows User Client Access License Software Assurance 32-Bit
ZFA-00379 - DYNAMICSCRMCALSNGLLICSAPACKOLVNL1YRACQY1 H21-00546 - Project Server For Windows User Client Access License Software Assurance 32-Bit
ZFA-00380 - DYNAMICSCRMCALSNGLLICSAPACKOLVNL1YRACQY2 H21-00528 - Project Server For Windows User Client Access License Software Assurance 32-Bit
ZFA-00382 - DYNAMICSCRMCALSNGLLICSAPACKOLVNL2YRACQY2 H21-00540 - Project Server For Windows User Client Access License Software Assurance 32-Bit
ZFA-00383 - DYNAMICSCRMCALSNGLLICSAPACKOLVNL3YRACQY1 H21-00547 - Project Server For Windows User Client Access License Software Assurance 32-Bit
ZFA-00058 - DYNAMICSCRMCALSNGLSAOLPCDEVICECAL H21-00551 - Project Server For Windows User Client Access License Software Assurance 32-Bit
ZFA-00051 - DYNAMICSCRMCALSNGLSAOLPCUSERCAL 076-03396 - PROJECTENGLISHLIC/SAPACKOLVNL1YRACQY2ADD
ZFA-00309 - DYNAMICSCRMCALSNGLSAOLVNL1YRACQY1ADDTLPR 076-03397 - PROJECTENGLISHLIC/SAPACKOLVNL1YRACQY3ADD
ZFA-00344 - DYNAMICSCRMCALSNGLSAOLVNL1YRACQY1ADDTLPR 076-03398 - PROJECTENGLISHLIC/SAPACKOLVNL2YRACQY2ADD
ZFA-00345 - DYNAMICSCRMCALSNGLSAOLVNL1YRACQY2ADDTLPR 076-03402 - PROJECTENGLISHSAOLVNL1YRACQY2ADDTLPROD
ZFA-00310 - DYNAMICSCRMCALSNGLSAOLVNL1YRACQY2ADDTLPR 076-03401 - PROJECTENGLISHSAOLVNL1YRACQY3ADDTLPROD
ZFA-00347 - DYNAMICSCRMCALSNGLSAOLVNL2YRACQY2ADDTLPR 076-03403 - PROJECTENGLISHSAOLVNL2YRACQY2ADDTLPROD
ZFA-00312 - DYNAMICSCRMCALSNGLSAOLVNL2YRACQY2ADDTLPR H30-01387 - PROJECTPROENGLISHLIC/SAOLVNL1YRACQY2ADDP
ZFA-00313 - DYNAMICSCRMCALSNGLSAOLVNL3YRACQY1ADDTLPR H30-01388 - PROJECTPROENGLISHLIC/SAOLVNL1YRACQY3ADDP
ZFA-00348 - DYNAMICSCRMCALSNGLSAOLVNL3YRACQY1ADDTLPR H30-01398 - PROJECTPROENGLISHSAOLVNL1YRACQY2ADDTLPRO
ZGA-00034 - DYNAMICSCRMEXTRNLCNCTRSNGLLIC/SAPACKOLPC H30-01397 - PROJECTPROENGLISHSAOLVNL1YRACQY3ADDTLPRO
ZGA-00199 - DYNAMICSCRMEXTRNLCNCTRSNGLLICSAPACKOLVNL H30-01399 - PROJECTPROENGLISHSAOLVNL2YRACQY2ADDTLPRO
ZGA-00201 - DYNAMICSCRMEXTRNLCNCTRSNGLLICSAPACKOLVNL H30-01392 - PROJECTPROENGLISHSASTEPUPOLVNL1YRACQY2AD
ZGA-00198 - DYNAMICSCRMEXTRNLCNCTRSNGLLICSAPACKOLVNL H30-01393 - PROJECTPROENGLISHSASTEPUPOLVNL1YRACQY3AD
ZGA-00202 - DYNAMICSCRMEXTRNLCNCTRSNGLLICSAPACKOLVNL H30-01394 - PROJECTPROENGLISHSASTEPUPOLVNL2YRACQY2AD
ZGA-00027 - DYNAMICSCRMEXTRNLCNCTRSNGLSAOLPC H21-01760 - PROJECTSERVERCALENGLISHLIC/SAOLVNL1YRACQ
ZGA-00049 - DYNAMICSCRMEXTRNLCNCTRSNGLSAOLPNL H21-01759 - PROJECTSERVERCALENGLISHLIC/SAOLVNL1YRACQ
ZGA-00164 - DYNAMICSCRMEXTRNLCNCTRSNGLSAOLVNL1YRACQY H21-01761 - PROJECTSERVERCALENGLISHLIC/SAOLVNL2YRACQ
ZGA-00163 - DYNAMICSCRMEXTRNLCNCTRSNGLSAOLVNL1YRACQY H21-01762 - PROJECTSERVERCALENGLISHLIC/SAOLVNL2YRACQ
ZGA-00166 - DYNAMICSCRMEXTRNLCNCTRSNGLSAOLVNL2YRACQY H21-01767 - PROJECTSERVERCALENGLISHSAOLVNL1YRACQY2AD
ZGA-00167 - DYNAMICSCRMEXTRNLCNCTRSNGLSAOLVNL3YRACQY H21-01770 - PROJECTSERVERCALENGLISHSAOLVNL1YRACQY2AD
QZA-00053 - DYNAMICSCRMLIMITEDCALSNGLSAOLPCDEVICECAL H21-01771 - PROJECTSERVERCALENGLISHSAOLVNL2YRACQY2AD
QZA-00426 - DYNAMICSCRMLIMITEDCALSNGLSAOLPCUSERCAL H21-01772 - PROJECTSERVERCALENGLISHSAOLVNL2YRACQY2AD
QZA-00032 - DYNAMICSCRMLIMITEDCALSNGLSAOLVNL1YRACQY1 H22-01280 - PROJECTSERVERENGLISHLIC/SAPACKOLVNL1YRAC
QZA-00238 - DYNAMICSCRMLIMITEDCALSNGLSAOLVNL1YRACQY1 H22-01281 - PROJECTSERVERENGLISHLIC/SAPACKOLVNL1YRAC
QZA-00026 - DYNAMICSCRMLIMITEDCALSNGLSAOLVNL1YRACQY2 H22-01282 - PROJECTSERVERENGLISHLIC/SAPACKOLVNL2YRAC
QZA-00239 - DYNAMICSCRMLIMITEDCALSNGLSAOLVNL1YRACQY2 H22-01286 - PROJECTSERVERENGLISHSAOLVNL1YRACQY2ADDTL
QZA-00241 - DYNAMICSCRMLIMITEDCALSNGLSAOLVNL2YRACQY2 H22-01287 - PROJECTSERVERENGLISHSAOLVNL2YRACQY2ADDTL
QZA-00028 - DYNAMICSCRMLIMITEDCALSNGLSAOLVNL2YRACQY2 S3Z-00004-12 - PROJONLNWPROJPROO365OPN D 1MTH AP
QZA-00242 - DYNAMICSCRMLIMITEDCALSNGLSAOLVNL3YRACQY1 S3Z-00007 - PROJONLNWPROJPROO365OPN LCLGOV QLFD
QZA-00029 - DYNAMICSCRMLIMITEDCALSNGLSAOLVNL3YRACQY1 S3Z-00001-12 - PROJONLNWPROJPROO365OPN NL 1MTH AP
QCA-00759 - DYNAMICSCRMPROSVRSNGLLICSAPACKOLVNL1YRAC S3Z-00003 - PROJONLNWPROJPROO365OPN QLFD
QCA-00796 - DYNAMICSCRMPROSVRSNGLSAOLVNL1YRACQY1ADDT 164-06987 - PUBLISHER 2013 32-BIT/X64 ENGLISH MDLESS
QAA-00111 - DYNAMICSCRMWORKGROUPSVRSNGLLICSAPACKOLVN 164-03900 - PUBLISHER ALL LNG LIC/SA PK OLV NL 1YR A
QAA-00114 - DYNAMICSCRMWORKGROUPSVRSNGLLICSAPACKOLVN 164-03719 - PUBLISHER ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
QAA-00113 - DYNAMICSCRMWORKGROUPSVRSNGLLICSAPACKOLVN 164-03723 - PUBLISHER ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
QAA-00269 - DYNAMICSCRMWORKGROUPSVRSNGLSAOLPC 164-03724 - PUBLISHER ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
QAA-00148 - DYNAMICSCRMWORKGROUPSVRSNGLSAOLVNL1YRACQ 164-03728 - PUBLISHER ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
QAA-00147 - DYNAMICSCRMWORKGROUPSVRSNGLSAOLVNL1YRACQ 164-02328 - Publisher For Windows Standard Edition Software Assurance 32-Bit Win License Onl
QAA-00150 - DYNAMICSCRMWORKGROUPSVRSNGLSAOLVNL2YRACQ 164-02511 - Publisher For Windows Standard Edition Software Assurance 32-Bit Win License Onl
QAA-00151 - DYNAMICSCRMWORKGROUPSVRSNGLSAOLVNL3YRACQ 164-02300 - Publisher For Windows Standard Edition Software Assurance 32-Bit Win License Onl
QYA-00588 - DYNCRMADDTVCAL ALNG LICSAPK OLV C 1Y AP 164-02415 - Publisher For Windows Standard Edition Software Assurance 32-Bit Win License Onl
QYA-00589 - DYNCRMADDTVCAL ALNG LICSAPK OLV C 1Y AP 164-02483 - Publisher For Windows Standard Edition Software Assurance 32-Bit Win License Onl
QYA-00154 - DYNCRMADDTVCAL ALNG LICSAPK OLV D 1Y AP 164-03721 - PUBLISHERENGLISHLIC/SAPACKOLVNL1YRACQY3A
QYA-00165 - DYNCRMADDTVCAL ALNG LICSAPK OLV D 1Y AP 164-03722 - PUBLISHERENGLISHLIC/SAPACKOLVNL2YRACQY2A
QYA-00180 - DYNCRMADDTVCALLICSAPKOLVD1YAQY2AP 164-03726 - PUBLISHERENGLISHSAOLVNL1YRACQY2ADDTLPROD
QYA-00169 - DYNCRMADDTVCALLICSAPKOLVD1YAQY2AP 164-03727 - PUBLISHERENGLISHSAOLVNL2YRACQY2ADDTLPROD
QYA-00158 - DYNCRMADDTVCALLICSAPKOLVD1YAQY3AP 079-06226 - PWRPOINT 2013 ENG OLP NL LCLGOV
QYA-00181 - DYNCRMADDTVCALLICSAPKOLVD1YAQY3AP 079-06204 - PWRPOINT 2013 SNGL OLP C
QYA-00170 - DYNCRMADDTVCALLICSAPKOLVD2YAQY2AP 079-06205 - PWRPOINT 2013 SNGL OLP NL
QYA-00159 - DYNCRMADDTVCALLICSAPKOLVD2YAQY2AP 079-05086 - PWRPOINT ALNG LICSAPK OLV C 1Y AP
QYA-00171 - DYNCRMADDTVCALLICSAPKOLVD3YAQY1AP 079-04668 - PWRPOINT ALNG LICSAPK OLV D 1Y AP
QYA-00160 - DYNCRMADDTVCALLICSAPKOLVD3YAQY1AP 079-04658 - PWRPOINTLICSAPKOLVD1YAQY1AP
QYA-00182 - DYNCRMADDTVCALSAOLVD1YAQY2APDVCCA 079-04659 - PWRPOINTLICSAPKOLVD1YAQY2AP
QYA-00196 - DYNCRMADDTVCALSAOLVD1YAQY2APUSRCA 079-04660 - PWRPOINTLICSAPKOLVD1YAQY3AP
QYA-00183 - DYNCRMADDTVCALSAOLVD1YAQY3APDVCCA 079-04661 - PWRPOINTLICSAPKOLVD2YAQY2AP
QYA-00197 - DYNCRMADDTVCALSAOLVD1YAQY3APUSRCA 079-04662 - PWRPOINTLICSAPKOLVD3YAQY1AP
QYA-00184 - DYNCRMADDTVCALSAOLVD2YAQY2APDVCCA D47-00539 - PWRPOINTMAC ALNG LICSAPK OLV C 1Y AP
QYA-00198 - DYNCRMADDTVCALSAOLVD2YAQY2APUSRCA D47-00411 - PWRPOINTMAC ALNG LICSAPK OLV D 1Y AP
QYA-00185 - DYNCRMADDTVCALSAOLVD3YAQY1APDVCCA D47-00403 - PWRPOINTMACLICSAPKOLVD1YAQY2AP
QYA-00199 - DYNCRMADDTVCALSAOLVD3YAQY1APUSRCA D47-00404 - PWRPOINTMACLICSAPKOLVD1YAQY3AP
QYA-00552 - DYNCRMADDTVCALSNGLLICSAPKOLVC1YAQY D47-00401 - PWRPOINTMACLICSAPKOLVD2YAQY2AP
QYA-00553 - DYNCRMADDTVCALSNGLLICSAPKOLVC1YAQY D47-00400 - PWRPOINTMACLICSAPKOLVD3YAQY1AP
QYA-00581 - DYNCRMADDTVCALSNGLLICSAPKOLVC1YAQY D47-00409 - PWRPOINTMACSAOLVD1YAQY2AP
QYA-00524 - DYNCRMADDTVCALSNGLLICSAPKOLVC1YAQY D47-00408 - PWRPOINTMACSAOLVD1YAQY3AP
QYA-00580 - DYNCRMADDTVCALSNGLLICSAPKOLVC1YAQY D47-00406 - PWRPOINTMACSAOLVD2YAQY2AP
QYA-00525 - DYNCRMADDTVCALSNGLLICSAPKOLVC1YAQY D47-00407 - PWRPOINTMACSAOLVD3YAQY1AP
QYA-00611 - DYNCRMADDTVCALSNGLLICSAPKOLVC2YAQY D47-00533 - PWRPOINTMACSNGLLICSAPKOLVC1YAQY1A
QYA-00610 - DYNCRMADDTVCALSNGLLICSAPKOLVC2YAQY D47-00535 - PWRPOINTMACSNGLLICSAPKOLVC1YAQY2A
QYA-00639 - DYNCRMADDTVCALSNGLLICSAPKOLVC3YAQY D47-00537 - PWRPOINTMACSNGLLICSAPKOLVC1YAQY3A
QYA-00638 - DYNCRMADDTVCALSNGLLICSAPKOLVC3YAQY D47-00540 - PWRPOINTMACSNGLLICSAPKOLVC2YAQY2A
QYA-00526 - DYNCRMADDTVCALSNGLSAOLVC1YAQY1AP D47-00542 - PWRPOINTMACSNGLLICSAPKOLVC3YAQY1A
QYA-00527 - DYNCRMADDTVCALSNGLSAOLVC1YAQY1AP D47-00534 - PWRPOINTMACSNGLSAOLVC1YAQY1AP
QYA-00555 - DYNCRMADDTVCALSNGLSAOLVC1YAQY2AP D47-00536 - PWRPOINTMACSNGLSAOLVC1YAQY2AP
QYA-00554 - DYNCRMADDTVCALSNGLSAOLVC1YAQY2AP D47-00538 - PWRPOINTMACSNGLSAOLVC1YAQY3AP
QYA-00582 - DYNCRMADDTVCALSNGLSAOLVC1YAQY3AP D47-00541 - PWRPOINTMACSNGLSAOLVC2YAQY2AP
QYA-00583 - DYNCRMADDTVCALSNGLSAOLVC1YAQY3AP D47-00543 - PWRPOINTMACSNGLSAOLVC3YAQY1AP
QYA-00612 - DYNCRMADDTVCALSNGLSAOLVC2YAQY2AP 079-04663 - PWRPOINTSAOLVD1YAQY1AP
QYA-00613 - DYNCRMADDTVCALSNGLSAOLVC2YAQY2AP 079-04665 - PWRPOINTSAOLVD1YAQY2AP
QYA-00640 - DYNCRMADDTVCALSNGLSAOLVC3YAQY1AP 079-04664 - PWRPOINTSAOLVD1YAQY3AP
QYA-00641 - DYNCRMADDTVCALSNGLSAOLVC3YAQY1AP 079-04666 - PWRPOINTSAOLVD2YAQY2AP
ZFA-00584 - DYNCRMCAL ALNG LICSAPK OLV C 1Y AP DVCCA 079-04667 - PWRPOINTSAOLVD3YAQY1AP
ZFA-00585 - DYNCRMCAL ALNG LICSAPK OLV C 1Y AP USRCA 079-05036 - PWRPOINTSNGLLICSAPKOLVC1YAQY1AP
ZFA-00301 - DYNCRMCAL ALNG LICSAPK OLV D 1Y AP DVCCA 079-05058 - PWRPOINTSNGLLICSAPKOLVC1YAQY2AP
ZFA-00288 - DYNCRMCAL ALNG LICSAPK OLV D 1Y AP USRCA 079-05080 - PWRPOINTSNGLLICSAPKOLVC1YAQY3AP
ZFA-00291 - DYNCRMCALLICSAPKOLVD1YAQY1APDVCCA 079-05104 - PWRPOINTSNGLLICSAPKOLVC2YAQY2AP
ZFA-00292 - DYNCRMCALLICSAPKOLVD1YAQY2APDVCCA 079-05126 - PWRPOINTSNGLLICSAPKOLVC3YAQY1AP
ZFA-00279 - DYNCRMCALLICSAPKOLVD1YAQY2APUSRCA 079-05037 - PWRPOINTSNGLSAOLVC1YAQY1AP
ZFA-00293 - DYNCRMCALLICSAPKOLVD1YAQY3APDVCCA 079-05059 - PWRPOINTSNGLSAOLVC1YAQY2AP
ZFA-00280 - DYNCRMCALLICSAPKOLVD1YAQY3APUSRCA 079-05081 - PWRPOINTSNGLSAOLVC1YAQY3AP
ZFA-00294 - DYNCRMCALLICSAPKOLVD2YAQY2APDVCCA 079-05105 - PWRPOINTSNGLSAOLVC2YAQY2AP
ZFA-00281 - DYNCRMCALLICSAPKOLVD2YAQY2APUSRCA 079-05127 - PWRPOINTSNGLSAOLVC3YAQY1AP
ZFA-00295 - DYNCRMCALLICSAPKOLVD3YAQY1APDVCCA S2Y-00001 - S2Y-00001-12
ZFA-00282 - DYNCRMCALLICSAPKOLVD3YAQY1APUSRCA S3Y-00001 - S3Y-00001-12
ZFA-00269 - DYNCRMCALSAOLVD1YAQY2APDVCCAL S3Y-00002 - S3Y-00002-12
ZFA-00259 - DYNCRMCALSAOLVD1YAQY2APUSRCAL T2Z-00028 - SA C 1Y AQY3 AP 2PROC
ZFA-00270 - DYNCRMCALSAOLVD1YAQY3APDVCCAL T2Z-00059 - SA D 1Y AQY1 AP 2PROC
ZFA-00260 - DYNCRMCALSAOLVD1YAQY3APUSRCAL YEG-01261 - SA OLV C 1Y AQY1 FORECAL DVCCAL
ZFA-00271 - DYNCRMCALSAOLVD2YAQY2APDVCCAL YEG-01263 - SA OLV C 1Y AQY1 FORECAL USRCAL
ZFA-00261 - DYNCRMCALSAOLVD2YAQY2APUSRCAL YEG-01321 - SA OLV C 1Y AQY1 PLTFRM DVCCAL
ZFA-00272 - DYNCRMCALSAOLVD3YAQY1APDVCCAL YEG-01375 - SA OLV C 1Y AQY1 PLTFRM FORECAL DVCCAL
ZFA-00262 - DYNCRMCALSAOLVD3YAQY1APUSRCAL YEG-01377 - SA OLV C 1Y AQY1 PLTFRM FORECAL USRCAL
ZFA-00520 - DYNCRMCALSNGLLICSAPKOLVC1YAQY1AP YEG-01323 - SA OLV C 1Y AQY1 PLTFRM USRCAL
ZFA-00521 - DYNCRMCALSNGLLICSAPKOLVC1YAQY1AP YEG-01303 - SA OLV C 3Y AQY1 FORECAL DVCCAL
ZFA-00549 - DYNCRMCALSNGLLICSAPKOLVC1YAQY2AP YEG-01305 - SA OLV C 3Y AQY1 FORECAL USRCAL
ZFA-00548 - DYNCRMCALSNGLLICSAPKOLVC1YAQY2AP YEG-01363 - SA OLV C 3Y AQY1 PLTFRM DVCCAL
ZFA-00577 - DYNCRMCALSNGLLICSAPKOLVC1YAQY3AP YEG-01417 - SA OLV C 3Y AQY1 PLTFRM FORECAL DVCCAL
ZFA-00576 - DYNCRMCALSNGLLICSAPKOLVC1YAQY3AP YEG-01419 - SA OLV C 3Y AQY1 PLTFRM FORECAL USRCAL
ZFA-00606 - DYNCRMCALSNGLLICSAPKOLVC2YAQY2AP YEG-01365 - SA OLV C 3Y AQY1 PLTFRM USRCAL
ZFA-00607 - DYNCRMCALSNGLLICSAPKOLVC2YAQY2AP YEG-01283 - SA OLV D 1Y AQY1 FORECAL DVCCAL
ZFA-00635 - DYNCRMCALSNGLLICSAPKOLVC3YAQY1AP YEG-01284 - SA OLV D 1Y AQY1 FORECAL USRCAL
ZFA-00634 - DYNCRMCALSNGLLICSAPKOLVC3YAQY1AP CW2-00083 - SA OLV D 1Y AQY1 AP
ZFA-00522 - DYNCRMCALSNGLSAOLVC1YAQY1APDVCCA YEG-01343 - SA OLV D 1Y AQY1 PLTFRM DVCCAL
ZFA-00523 - DYNCRMCALSNGLSAOLVC1YAQY1APUSRCA YEG-01397 - SA OLV D 1Y AQY1 PLTFRM FORECAL DVCCAL
ZFA-00550 - DYNCRMCALSNGLSAOLVC1YAQY2APDVCCA YEG-01398 - SA OLV D 1Y AQY1 PLTFRM FORECAL USRCAL
ZFA-00551 - DYNCRMCALSNGLSAOLVC1YAQY2APUSRCA YEG-01344 - SA OLV D 1Y AQY1 PLTFRM USRCAL
ZFA-00578 - DYNCRMCALSNGLSAOLVC1YAQY3APDVCCA CW2-00087 - SA OLV D 1Y AQY2 AP
ZFA-00579 - DYNCRMCALSNGLSAOLVC1YAQY3APUSRCA CW2-00091 - SA OLV D 1Y AQY3 AP
ZFA-00608 - DYNCRMCALSNGLSAOLVC2YAQY2APDVCCA CW2-00118 - SA OLV D 2Y AQY2 AP
ZFA-00609 - DYNCRMCALSNGLSAOLVC2YAQY2APUSRCA YEG-01309 - SA OLV D 3Y AQY1 FORECAL DVCCAL
ZFA-00636 - DYNCRMCALSNGLSAOLVC3YAQY1APDVCCA YEG-01310 - SA OLV D 3Y AQY1 FORECAL USRCAL
ZFA-00637 - DYNCRMCALSNGLSAOLVC3YAQY1APUSRCA CW2-00169 - SA OLV D 3Y AQY1 AP
ZGA-00303 - DYNCRMEXTCONN ALNG LICSAPK OLV C 1Y AP YEG-01250 - SA OLV D 3Y AQY1 ENT USRCAL
ZGA-00155 - DYNCRMEXTCONN ALNG LICSAPK OLV D 1Y AP YEG-01369 - SA OLV D 3Y AQY1 PLTFRM DVCCAL
ZGA-00146 - DYNCRMEXTCONNLICSAPKOLVD1YAQY2AP YEG-01423 - SA OLV D 3Y AQY1 PLTFRM FORECAL DVCCAL
ZGA-00147 - DYNCRMEXTCONNLICSAPKOLVD1YAQY3AP YEG-01424 - SA OLV D 3Y AQY1 PLTFRM FORECAL USRCAL
ZGA-00148 - DYNCRMEXTCONNLICSAPKOLVD2YAQY2AP YEG-01370 - SA OLV D 3Y AQY1 PLTFRM USRCAL
ZGA-00149 - DYNCRMEXTCONNLICSAPKOLVD3YAQY1AP YEG-01262 - SA OLV NL 1Y AQY1 FORECAL DVCCAL
ZGA-00136 - DYNCRMEXTCONNSAOLVD1YAQY2AP YEG-01264 - SA OLV NL 1Y AQY1 FORECAL USRCAL
ZGA-00137 - DYNCRMEXTCONNSAOLVD1YAQY3AP YEG-01322 - SA OLV NL 1Y AQY1 PLTFRM DVCCAL
ZGA-00138 - DYNCRMEXTCONNSAOLVD2YAQY2AP YEG-01376 - SA OLV NL 1Y AQY1 PLTFRM FORECAL DVCCAL
ZGA-00139 - DYNCRMEXTCONNSAOLVD3YAQY1AP YEG-01378 - SA OLV NL 1Y AQY1 PLTFRM FORECAL USRCAL
ZGA-00271 - DYNCRMEXTCONNSNGLLICSAPKOLVC1YAQY1 YEG-01324 - SA OLV NL 1Y AQY1 PLTFRM USRCAL
ZGA-00285 - DYNCRMEXTCONNSNGLLICSAPKOLVC1YAQY2 YEG-01304 - SA OLV NL 3Y AQY1 FORECAL DVCCAL
ZGA-00299 - DYNCRMEXTCONNSNGLLICSAPKOLVC1YAQY3 YEG-01306 - SA OLV NL 3Y AQY1 FORECAL USRCAL
ZGA-00314 - DYNCRMEXTCONNSNGLLICSAPKOLVC2YAQY2 YEG-01364 - SA OLV NL 3Y AQY1 PLTFRM DVCCAL
ZGA-00328 - DYNCRMEXTCONNSNGLLICSAPKOLVC3YAQY1 YEG-01418 - SA OLV NL 3Y AQY1 PLTFRM FORECAL DVCCAL
ZGA-00272 - DYNCRMEXTCONNSNGLSAOLVC1YAQY1AP YEG-01420 - SA OLV NL 3Y AQY1 PLTFRM FORECAL USRCAL
ZGA-00286 - DYNCRMEXTCONNSNGLSAOLVC1YAQY2AP YEG-01366 - SA OLV NL 3Y AQY1 PLTFRM USRCAL
ZGA-00300 - DYNCRMEXTCONNSNGLSAOLVC1YAQY3AP M3J-00090 - SCEDPINTPRTCN SBSVL OLV D 1MTH AP 1DVC
ZGA-00315 - DYNCRMEXTCONNSNGLSAOLVC2YAQY2AP M3J-00091 - SCENDPNTPRTCN SBSVL OLV D 1MTH AP1RUSR
ZGA-00329 - DYNCRMEXTCONNSNGLSAOLVC3YAQY1AP M3J-00091 - SCENDPNTPRTCN SBSVL OLV D 1MTH AP1RUSR
QZA-00588 - DYNCRMLTDCAL ALNG LICSAPK OLV C 1Y AP DV 76N-03634 - SHAREPNTENTCAL 2013 OLPNL LCLGOV DVCCAL
QZA-00589 - DYNCRMLTDCAL ALNG LICSAPK OLV C 1Y AP US 76N-03645 - SHAREPNTETCAL 2013 OLP NL LCLGOV USRCAL
QZA-00017 - DYNCRMLTDCAL ALNG LICSAPK OLV D 1Y AP DV 76N-03598 - SHAREPOINT ENTERPRISE CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 L
QZA-00249 - DYNCRMLTDCAL ALNG LICSAPK OLV D 1Y AP US 76N-03594 - SHAREPOINT ENTERPRISE CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 L
QZA-00114 - DYNCRMLTDCALLICSAPKOLVD1YAQY2APDV 76N-03596 - SHAREPOINT ENTERPRISE CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 L
QZA-00370 - DYNCRMLTDCALLICSAPKOLVD1YAQY2APUS 76N-03595 - SHAREPOINT ENTERPRISE CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 L
QZA-00115 - DYNCRMLTDCALLICSAPKOLVD1YAQY3APDV 76N-03597 - SHAREPOINT ENTERPRISE CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 L
QZA-00374 - DYNCRMLTDCALLICSAPKOLVD1YAQY3APUS 76N-03599 - SHAREPOINT ENTERPRISE CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 L
QZA-00108 - DYNCRMLTDCALLICSAPKOLVD2YAQY2APDV 76N-01116 - SHAREPOINT ENTERPRISE CAL ALLLNG LIC/SA
QZA-00375 - DYNCRMLTDCALLICSAPKOLVD2YAQY2APUS 76N-01514 - SHAREPOINT ENTERPRISE CAL ALLLNG LIC/SA
QZA-00109 - DYNCRMLTDCALLICSAPKOLVD3YAQY1APDV 76N-01572 - SHAREPOINT ENTERPRISE CAL ENGLISH LIC/SA OLVNL 1YRACQY2 ADDPRD USER
QZA-00376 - DYNCRMLTDCALLICSAPKOLVD3YAQY1APUS 76N-00713 - SharePoint Enterprise CAL English Lic/SA Pack OLP C Device CAL
QZA-00116 - DYNCRMLTDCALSAOLVD1YAQY2APDVCCAL 76N-00013 - SharePoint Enterprise CAL English Lic/SA Pack OLP C User CAL
QZA-00372 - DYNCRMLTDCALSAOLVD1YAQY2APUSRCAL 76N-00072 - SharePoint Enterprise CAL English Lic/SA Pack OLP NL Device CAL
QZA-00117 - DYNCRMLTDCALSAOLVD1YAQY3APDVCCAL 76N-00663 - SharePoint Enterprise CAL English Lic/SA Pack OLP NL Locl Govt Device CAL
QZA-00373 - DYNCRMLTDCALSAOLVD1YAQY3APUSRCAL 76N-00677 - SharePoint Enterprise CAL English Lic/SA Pack OLP NL Locl Govt User CAL
QZA-00106 - DYNCRMLTDCALSAOLVD2YAQY2APDVCCAL 76N-00839 - SharePoint Enterprise CAL English Lic/SA Pack OLP NL User CAL
QZA-00365 - DYNCRMLTDCALSAOLVD2YAQY2APUSRCAL 76N-01571 - SHAREPOINT ENTERPRISE CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD USE
QZA-00112 - DYNCRMLTDCALSAOLVD3YAQY1APDVCCAL 76N-00877 - SharePoint Enterprise CAL English SA OLP C Device CAL
QZA-00366 - DYNCRMLTDCALSAOLVD3YAQY1APUSRCAL 76N-00953 - SharePoint Enterprise CAL English SA OLP C User CAL
QZA-00524 - DYNCRMLTDCALSNGLLICSAPKOLVC1YAQY1 76N-01012 - SharePoint Enterprise CAL English SA OLP NL Device CAL
QZA-00525 - DYNCRMLTDCALSNGLLICSAPKOLVC1YAQY1 76N-00684 - SharePoint Enterprise CAL English SA OLP NL Locl Govt Device CAL
QZA-00552 - DYNCRMLTDCALSNGLLICSAPKOLVC1YAQY2 76N-00698 - SharePoint Enterprise CAL English SA OLP NL Locl Govt User CAL
QZA-00553 - DYNCRMLTDCALSNGLLICSAPKOLVC1YAQY2 76N-01088 - SharePoint Enterprise CAL English SA OLP NL User CAL
QZA-00580 - DYNCRMLTDCALSNGLLICSAPKOLVC1YAQY3 H05-01748 - SHAREPOINT PORTAL CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CA
QZA-00581 - DYNCRMLTDCALSNGLLICSAPKOLVC1YAQY3 H05-01751 - SHAREPOINT PORTAL CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL
QZA-00610 - DYNCRMLTDCALSNGLLICSAPKOLVC2YAQY2 H05-01756 - SHAREPOINT PORTAL CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CA
QZA-00611 - DYNCRMLTDCALSNGLLICSAPKOLVC2YAQY2 H05-01757 - SHAREPOINT PORTAL CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL
QZA-00639 - DYNCRMLTDCALSNGLLICSAPKOLVC3YAQY1 H05-01758 - SHAREPOINT PORTAL CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL
QZA-00638 - DYNCRMLTDCALSNGLLICSAPKOLVC3YAQY1 H05-01761 - SHAREPOINT PORTAL CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL
QZA-00526 - DYNCRMLTDCALSNGLSAOLVC1YAQY1APDV H05-01766 - SHAREPOINT PORTAL CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL
QZA-00527 - DYNCRMLTDCALSNGLSAOLVC1YAQY1APUS H05-01767 - SHAREPOINT PORTAL CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL
QZA-00554 - DYNCRMLTDCALSNGLSAOLVC1YAQY2APDV H05-00165 - SharePoint Portal For Windows Device Client Access License Software Assurance Wi
QZA-00555 - DYNCRMLTDCALSNGLSAOLVC1YAQY2APUS H05-00192 - SharePoint Portal For Windows Device Client Access License Software Assurance Wi
QZA-00582 - DYNCRMLTDCALSNGLSAOLVC1YAQY3APDV H05-00235 - SharePoint Portal For Windows Device Client Access License Software Assurance Wi
QZA-00583 - DYNCRMLTDCALSNGLSAOLVC1YAQY3APUS H05-00252 - SharePoint Portal For Windows Device Client Access License Software Assurance Wi
QZA-00612 - DYNCRMLTDCALSNGLSAOLVC2YAQY2APDV H05-00254 - SharePoint Portal For Windows Device Client Access License Software Assurance Wi
QZA-00613 - DYNCRMLTDCALSNGLSAOLVC2YAQY2APUS H05-00167 - SharePoint Portal For Windows Device Client Access License Software Assurance Wi
QZA-00640 - DYNCRMLTDCALSNGLSAOLVC3YAQY1APDV H04-00221 - SharePoint Portal For Windows Server Software Assurance Win 2K License Only NO M
QZA-00641 - DYNCRMLTDCALSNGLSAOLVC3YAQY1APUS H04-00223 - SharePoint Portal For Windows Server Software Assurance Win 2K License Only NO M
6MR-00003 - DYNCRMNPRMMBLE SBSVL OLV C 1MTH AP 1USR H04-00292 - SharePoint Portal For Windows Server Software Assurance Win 2K License Only NO M
6MR-00003 - DYNCRMNPRMMBLE SBSVL OLV C 1MTH AP 1USR H04-00294 - SharePoint Portal For Windows Server Software Assurance Win 2K License Only NO M
6MR-00007 - DYNCRMNPRMMBLE SBSVL OLV D 1MTH AP 1USR H04-00249 - SharePoint Portal For Windows Server Software Assurance Win 2K License Only NO M
6MR-00007 - DYNCRMNPRMMBLE SBSVL OLV D 1MTH AP 1USR H04-00312 - SharePoint Portal For Windows Server Software Assurance Win 2K License Only NO M
6MR-00004 - DYNCRMNPRMMBLE SBSVL OLV NL 1MTH AP 1USR H05-00377 - SharePoint Portal For Windows User Client Access License Software Assurance Win
6MR-00004 - DYNCRMNPRMMBLE SBSVL OLV NL 1MTH AP 1USR H05-00382 - SharePoint Portal For Windows User Client Access License Software Assurance Win
N9J-00773 - DYNCRMSVR ALNG LICSAPK H05-00392 - SharePoint Portal For Windows User Client Access License Software Assurance Win
P3J-00032 - DYNCRMSVRRYLTY 2013 ENG H05-00387 - SharePoint Portal For Windows User Client Access License Software Assurance Win
QAA-00382 - DYNCRMWKGRPSVR ALNG LICSAPK OLV C 1Y 5CL H05-00391 - SharePoint Portal For Windows User Client Access License Software Assurance Win
QAA-00163 - DYNCRMWKGRPSVR ALNG LICSAPK OLV D 1Y AP H05-00396 - SharePoint Portal For Windows User Client Access License Software Assurance Win
QAA-00166 - DYNCRMWKGRPSVRLICSAPKOLVD1YAQY2AP H04-01316 - SHAREPOINT PORTAL SVR ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
QAA-00167 - DYNCRMWKGRPSVRLICSAPKOLVD1YAQY3AP H04-01320 - SHAREPOINT PORTAL SVR ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
QAA-00168 - DYNCRMWKGRPSVRLICSAPKOLVD2YAQY2AP H04-01321 - SHAREPOINT PORTAL SVR ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
QAA-00169 - DYNCRMWKGRPSVRLICSAPKOLVD3YAQY1AP H04-01325 - SHAREPOINT PORTAL SVR ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
QAA-00180 - DYNCRMWKGRPSVRSAOLVD1YAQY2AP 76M-01416 - SHAREPOINT STANDARD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LIC
QAA-00181 - DYNCRMWKGRPSVRSAOLVD1YAQY3AP 76M-01415 - SHAREPOINT STANDARD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LIC
QAA-00170 - DYNCRMWKGRPSVRSAOLVD2YAQY2AP 76M-01417 - SHAREPOINT STANDARD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LIC
QAA-00171 - DYNCRMWKGRPSVRSAOLVD3YAQY1AP 76M-01418 - SHAREPOINT STANDARD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LIC
QAA-00363 - DYNCRMWKGRPSVRSNGLLICSAPKOLVC1YAQY 76M-01420 - SHAREPOINT STANDARD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LIC
QAA-00378 - DYNCRMWKGRPSVRSNGLLICSAPKOLVC1YAQY 76M-01419 - SHAREPOINT STANDARD CAL ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LIC
QAA-00349 - DYNCRMWKGRPSVRSNGLLICSAPKOLVC1YAQY 76N-03698 - SHAREPOINTENTCAL 2013 SNGL OLP C DVCCAL
QAA-00393 - DYNCRMWKGRPSVRSNGLLICSAPKOLVC2YAQY 76N-03700 - SHAREPOINTENTCAL 2013 SNGL OLP C USRCAL
QAA-00407 - DYNCRMWKGRPSVRSNGLLICSAPKOLVC3YAQY 76N-03699 - SHAREPOINTENTCAL 2013 SNGL OLP NL DVCCAL
QAA-00350 - DYNCRMWKGRPSVRSNGLSAOLVC1YAQY15CL 76N-03701 - SHAREPOINTENTCAL 2013 SNGL OLP NL USRCAL
QAA-00364 - DYNCRMWKGRPSVRSNGLSAOLVC1YAQY25CL 76N-03313 - SHAREPOINTENTCAL ALNG LICSAPK OLV C 1Y A
QAA-00379 - DYNCRMWKGRPSVRSNGLSAOLVC1YAQY35CL 76N-03312 - SHAREPOINTENTCAL ALNG LICSAPK OLV C 1Y A
QAA-00394 - DYNCRMWKGRPSVRSNGLSAOLVC2YAQY25CL 76N-03092 - SHAREPOINTENTCAL ALNG LICSAPK OLV D 1Y A
QAA-00408 - DYNCRMWKGRPSVRSNGLSAOLVC3YAQY15CL 76N-03085 - SHAREPOINTENTCAL ALNG LICSAPK OLV D 1Y A
ZFA-00204 - DYNMCCRMCALENGLICSAPACKOLPNLLCGVTDVCCALQ 76N-03086 - SHAREPOINTENTCALLICSAPKOLVD1YAQY1A
ZFA-00203 - DYNMCCRMCALENGLICSAPACKOLPNLLCGVTUSERCAL 76N-03093 - SHAREPOINTENTCALLICSAPKOLVD1YAQY1A
ZFA-00202 - DYNMCCRMCALENGSAOLPNLLCGVTDVCCALQULF 76N-03087 - SHAREPOINTENTCALLICSAPKOLVD1YAQY2A
ZFA-00201 - DYNMCCRMCALENGSAOLPNLLCGVTUSERCALQULF 76N-03094 - SHAREPOINTENTCALLICSAPKOLVD1YAQY2A
ZFA-00072 - DYNMCCRMCALSNGLLICSAPACKOLPCDVCCAL 76N-03095 - SHAREPOINTENTCALLICSAPKOLVD1YAQY3A
ZFA-00116 - DYNMCCRMCALSNGLLICSAPACKOLPNLDVCCALQULF 76N-03088 - SHAREPOINTENTCALLICSAPKOLVD1YAQY3A
ZFA-00102 - DYNMCCRMCALSNGLSAOLPNLDVCCALQULF 76N-03096 - SHAREPOINTENTCALLICSAPKOLVD2YAQY2A
ZFA-00095 - DYNMCCRMCALSNGLSAOLPNLUSERCALQULF 76N-03089 - SHAREPOINTENTCALLICSAPKOLVD2YAQY2A
ZGA-00102 - DYNMCCRMEXTRNLCNCTRENGLICSAPACKOLPNLLCGV 76N-03090 - SHAREPOINTENTCALLICSAPKOLVD3YAQY1A
ZGA-00101 - DYNMCCRMEXTRNLCNCTRENGSAOLPNLLCGVT 76N-03097 - SHAREPOINTENTCALLICSAPKOLVD3YAQY1A
ZGA-00056 - DYNMCCRMEXTRNLCNCTRSNGLLICSAPACKOLPNL 76N-03099 - SHAREPOINTENTCALSAOLVD1YAQY1APDVC
QZA-00045 - DYNMCCRMLIMITEDCALENGLICSAPACKOLPNLLCGVT 76N-03104 - SHAREPOINTENTCALSAOLVD1YAQY1APUSR
QZA-00442 - DYNMCCRMLIMITEDCALENGLICSAPACKOLPNLLCGVT 76N-03100 - SHAREPOINTENTCALSAOLVD1YAQY2APDVC
QZA-00048 - DYNMCCRMLIMITEDCALENGSAOLPNLLCGVTDVCCALQ 76N-03105 - SHAREPOINTENTCALSAOLVD1YAQY2APUSR
QZA-00440 - DYNMCCRMLIMITEDCALENGSAOLPNLLCGVTUSERCAL 76N-03101 - SHAREPOINTENTCALSAOLVD1YAQY3APDVC
QZA-00059 - DYNMCCRMLIMITEDCALSNGLLICSAPACKOLPCDVCCA 76N-03106 - SHAREPOINTENTCALSAOLVD1YAQY3APUSR
QZA-00427 - DYNMCCRMLIMITEDCALSNGLLICSAPACKOLPCUSERC 76N-03102 - SHAREPOINTENTCALSAOLVD2YAQY2APDVC
QZA-00056 - DYNMCCRMLIMITEDCALSNGLLICSAPACKOLPNLDVCC 76N-03107 - SHAREPOINTENTCALSAOLVD2YAQY2APUSR
QZA-00431 - DYNMCCRMLIMITEDCALSNGLLICSAPACKOLPNLUSER 76N-03103 - SHAREPOINTENTCALSAOLVD3YAQY1APDVC
QZA-00062 - DYNMCCRMLIMITEDCALSNGLSAOLPNLDVCCALQULF 76N-03108 - SHAREPOINTENTCALSAOLVD3YAQY1APUSR
QZA-00430 - DYNMCCRMLIMITEDCALSNGLSAOLPNLUSERCALQULF 76N-03249 - SHAREPOINTENTCALSNGLLICSAPKOLVC1YA
QAA-00192 - DYNMCCRMWORKGROUPSVRENGLICSAPACKOLPNLLCG 76N-03248 - SHAREPOINTENTCALSNGLLICSAPKOLVC1YA
QAA-00191 - DYNMCCRMWORKGROUPSVRENGSAOLPNLLCGVTQULF 76N-03276 - SHAREPOINTENTCALSNGLLICSAPKOLVC1YA
QAA-00264 - DYNMCCRMWORKGROUPSVRSNGLLICSAPACKOLPC 76N-03305 - SHAREPOINTENTCALSNGLLICSAPKOLVC1YA
QAA-00238 - DYNMCCRMWORKGROUPSVRSNGLLICSAPACKOLPNLQU 76N-03304 - SHAREPOINTENTCALSNGLLICSAPKOLVC1YA
QAA-00243 - DYNMCCRMWORKGROUPSVRSNGLSAOLPNLQULF 76N-03277 - SHAREPOINTENTCALSNGLLICSAPKOLVC1YA
ZFA-00417 - DYNMCSCRMCALSNGLLICSAPKOLVNL1YRACQY1DEVI 76N-03335 - SHAREPOINTENTCALSNGLLICSAPKOLVC2YA
ZFA-00418 - DYNMCSCRMCALSNGLLICSAPKOLVNL1YRACQY2DEVI 76N-03334 - SHAREPOINTENTCALSNGLLICSAPKOLVC2YA
ZFA-00420 - DYNMCSCRMCALSNGLLICSAPKOLVNL2YRACQY2DEVI 76N-03363 - SHAREPOINTENTCALSNGLLICSAPKOLVC3YA
ZFA-00421 - DYNMCSCRMCALSNGLLICSAPKOLVNL3YRACQY1DEVI 76N-03362 - SHAREPOINTENTCALSNGLLICSAPKOLVC3YA
QYA-00251 - DYNMCSCRMFULLUSECALENGLICSAPACKOLPNLLCGV 76N-03250 - SHAREPOINTENTCALSNGLSAOLVC1YAQY1A
QYA-00250 - DYNMCSCRMFULLUSECALENGLICSAPACKOLPNLLCGV 76N-03251 - SHAREPOINTENTCALSNGLSAOLVC1YAQY1A
QYA-00249 - DYNMCSCRMFULLUSECALENGSAOLPNLLCGVTDVCCAL 76N-03279 - SHAREPOINTENTCALSNGLSAOLVC1YAQY2A
QYA-00248 - DYNMCSCRMFULLUSECALENGSAOLPNLLCGVTUSERCA 76N-03278 - SHAREPOINTENTCALSNGLSAOLVC1YAQY2A
QYA-00387 - DYNMCSCRMFULLUSECALSNGLLICSAPACKOLPCDVCC 76N-03306 - SHAREPOINTENTCALSNGLSAOLVC1YAQY3A
QYA-00392 - DYNMCSCRMFULLUSECALSNGLLICSAPACKOLPCUSER 76N-03307 - SHAREPOINTENTCALSNGLSAOLVC1YAQY3A
QYA-00335 - DYNMCSCRMFULLUSECALSNGLLICSAPACKOLPNLDVC 76N-03337 - SHAREPOINTENTCALSNGLSAOLVC2YAQY2A
QYA-00340 - DYNMCSCRMFULLUSECALSNGLLICSAPACKOLPNLUSE 76N-03336 - SHAREPOINTENTCALSNGLSAOLVC2YAQY2A
QYA-00042 - DYNMCSCRMFULLUSECALSNGLLICSAPKOLVNL1YRAC 76N-03365 - SHAREPOINTENTCALSNGLSAOLVC3YAQY1A
QYA-00076 - DYNMCSCRMFULLUSECALSNGLLICSAPKOLVNL1YRAC 76N-03364 - SHAREPOINTENTCALSNGLSAOLVC3YAQY1A
QYA-00043 - DYNMCSCRMFULLUSECALSNGLLICSAPKOLVNL1YRAC 76N-01173 - SHAREPOINTENTERPRISECALENGLISHLIC/SAOLVN
QYA-00077 - DYNMCSCRMFULLUSECALSNGLLICSAPKOLVNL1YRAC 76N-01175 - SHAREPOINTENTERPRISECALENGLISHLIC/SAOLVN
QYA-00079 - DYNMCSCRMFULLUSECALSNGLLICSAPKOLVNL2YRAC 76N-01176 - SHAREPOINTENTERPRISECALENGLISHLIC/SAOLVN
QYA-00034 - DYNMCSCRMFULLUSECALSNGLLICSAPKOLVNL3YRAC 76N-01177 - SHAREPOINTENTERPRISECALENGLISHLIC/SAOLVN
QYA-00068 - DYNMCSCRMFULLUSECALSNGLLICSAPKOLVNL3YRAC 76N-01573 - SHAREPOINTENTERPRISECALENGLISHLIC/SAOLVN
QYA-00397 - DYNMCSCRMFULLUSECALSNGLSAOLPCDEVICECAL 76N-01574 - SHAREPOINTENTERPRISECALENGLISHLIC/SAOLVN
QYA-00402 - DYNMCSCRMFULLUSECALSNGLSAOLPCUSERCAL 76N-01575 - SHAREPOINTENTERPRISECALENGLISHLIC/SAOLVN
QYA-00357 - DYNMCSCRMFULLUSECALSNGLSAOLPNLDVCCALQULF 76N-01174 - SHAREPOINTENTERPRISECALENGLISHLIC/SAOLVN
QYA-00362 - DYNMCSCRMFULLUSECALSNGLSAOLPNLUSERCALQUL 76N-01768 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL1YR
QYA-00113 - DYNMCSCRMFULLUSECALSNGLSAOLVNL1YRACQY1AD 76N-01769 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL1YR
QYA-00150 - DYNMCSCRMFULLUSECALSNGLSAOLVNL1YRACQY1AD 76N-01770 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL1YR
QYA-00151 - DYNMCSCRMFULLUSECALSNGLSAOLVNL1YRACQY2AD 76N-02078 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL1YR
QYA-00114 - DYNMCSCRMFULLUSECALSNGLSAOLVNL1YRACQY2AD 76N-02079 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL1YR
QYA-00141 - DYNMCSCRMFULLUSECALSNGLSAOLVNL2YRACQY2AD 76N-02080 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL1YR
QYA-00104 - DYNMCSCRMFULLUSECALSNGLSAOLVNL2YRACQY2AD 76N-02081 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL2YR
QYA-00142 - DYNMCSCRMFULLUSECALSNGLSAOLVNL3YRACQY1AD 76N-01771 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL2YR
QYA-00105 - DYNMCSCRMFULLUSECALSNGLSAOLVNL3YRACQY1AD 76N-01772 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL3YR
QZA-00020 - DYNMCSCRMLIMITEDCALSNGLLICSAPKOLVNL1YRAC 76N-02082 - SHAREPOINTENTERPRISECALENGLISHSAOLVNL3YR
QZA-00237 - DYNMCSCRMLIMITEDCALSNGLLICSAPKOLVNL1YRAC 9ED-00044 - SHAREPOINTINTRNTSITESENT ALNG SASU MVL
QZA-00243 - DYNMCSCRMLIMITEDCALSNGLLICSAPKOLVNL1YRAC 6KD-00041 - SHAREPOINTINTRNTSITESENT SNGL LICSAPK
QZA-00019 - DYNMCSCRMLIMITEDCALSNGLLICSAPKOLVNL1YRAC CLF-00022 - SHAREPOINTINTRNTSITESSTD SNGL LICSAPK
QZA-00245 - DYNMCSCRMLIMITEDCALSNGLLICSAPKOLVNL2YRAC CKF-00024 - SHAREPOINTINTRNTSNGLOLV NL 1Y AQY1 AP
QZA-00012 - DYNMCSCRMLIMITEDCALSNGLLICSAPKOLVNL2YRAC 76M-01477 - SHAREPOINTSTDCAL 2013 OLPNLLCLGOV DVCCAL
QZA-00018 - DYNMCSCRMLIMITEDCALSNGLLICSAPKOLVNL3YRAC 76M-01512 - SHAREPOINTSTDCAL 2013 SNGL OLP C DVCCAL
QZA-00246 - DYNMCSCRMLIMITEDCALSNGLLICSAPKOLVNL3YRAC 76M-01517 - SHAREPOINTSTDCAL 2013 SNGL OLP C USRCAL
7JT-00009-12 - E1ARCHVNGALNG OLV D 1MTH EACH PLTFRM 76M-01513 - SHAREPOINTSTDCAL 2013 SNGL OLP NL DVCCAL
7JT-00007-12 - E1ARCHVNGALNG SUBSVL OLV D 1MTH EACH ENT 76M-01518 - SHAREPOINTSTDCAL 2013 SNGL OLP NL USRCAL
7JT-00008 - E1ARCHVNGALNG SUBSVL OLV D 1MTH ENT 77D-00076 - SHAREPOINTSVR 2010 64BIT BRZLN DISKKIT
7JT-00010 - E1ARCHVNGALNG SUBSVL OLV D 1MTH PLTFRM 77D-00077 - SHAREPOINTSVR 2010 64BIT BRZLN DISKKIT
Q4Y-00018-12 - E1OPENALNG OLV NL 1MTH EACH PLTFRM 76P-01515 - SHAREPOINTSVR 2013 ENG OLP NL LCLGOV
Q4Y-00020-12 - E1OPENALNG SUBSVL OLV D 1MTH EACH ENT 76P-01500 - SHAREPOINTSVR 2013 SNGL OLP C
Q4Y-00022-12 - E1OPENALNG SUBSVL OLV D 1MTH EACH PLTFRM 76P-01501 - SHAREPOINTSVR 2013 SNGL OLP NL
Q4Y-00021 - E1OPENALNG SUBSVL OLV D 1MTH ENT 3NN-00022-12 - SHRDSVR ALNG SUBSVL OLV D 1MTH AP
Q4Y-00023 - E1OPENALNG SUBSVL OLV D 1MTH PLTFRM 3NN-00019-12 - SHRDSVR ALNG SUBSVL OLV NL 1MTH AP
Q4Y-00016-12 - E1OPENALNG SUBSVL OLV NL 1MTH EACH ENT 3NN-00025 - SHRDSVR ENG SUBSVLNL ANNUALLCLGOVQLFD
Q4Y-00017 - E1OPENALNG SUBSVL OLV NL 1MTH ENT 3NN-00020 - SHRDSVR SNGL SUBSVL OLV NL 1MTH AP
Q4Y-00019 - E1OPENALNG SUBSVL OLV NL 1MTH PLTFRM 3NN-00021 - SHRDSVR SNGL SUBSVLNL ANNUAL QLFD
Q5Y-00028-12 - E3OPENALNG OLV NL 1MTH EACH PLTFRM 3NN-00023 - SHRDSVR SUBSVL OLV D 1MTH AP
Q5Y-00030-12 - E3OPENALNG SUBSVL OLV D 1MTH EACH ENT 76M-01478 - SHREPNTSTDCAL 2013 OLP NL LCLGOV USRCAL
Q5Y-00032-12 - E3OPENALNG SUBSVL OLV D 1MTH EACH PLTFRM Q9Z-00003 - SHRPNTONLNPLAN1OPEN NL
Q5Y-00031 - E3OPENALNG SUBSVL OLV D 1MTH ENT Q9Z-00007 - SHRPNTONLNPLAN1OPEN ENG NL LCLGOV
Q5Y-00026-12 - E3OPENALNG SUBSVL OLV NL 1MTH EACH ENT Q9Z-00004-12 - SHRPNTONLNPLAN1OPEN SHRDSVRDAP
Q5Y-00027 - E3OPENALNG SUBSVL OLV NL 1MTH ENT Q9Z-00002-12 - SHRPNTONLNPLAN1OPEN SHRDSVRNLAP
Q5Y-00029 - E3OPENALNG SUBSVL OLV NL 1MTH PLTFRM Q9Z-00005 - SHRPNTONLNPLAN1OPENDAP
PGI-00579 - ECHGETCAL 2013 OLP NL LLGOV DCCAL WOSRCS Q9Z-00001 - SHRPNTONLNPLAN1OPENNLAP
PGI-00580 - ECHGETCL 2013 OLP NL LCLGV USRCL WOSRVCS R2Z-00003 - SHRPNTONLNPLAN2OPEN NL
C6R-00058 - ENCRTAPREMONLNSNGLSUBSVLOLVC1MTHAP R2Z-00007 - SHRPNTONLNPLAN2OPEN ENG NL LCLGOV
C6R-00058 - ENCRTAPREMONLNSNGLSUBSVLOLVC1MTHAP R2Z-00004-12 - SHRPNTONLNPLAN2OPEN SHRDSVRDAP
C6R-00048 - ENCRTAPREMONLNSUBSVLOLVD1MTHAPPERU R2Z-00002-12 - SHRPNTONLNPLAN2OPEN SHRDSVRNLAP
C6R-00048 - ENCRTAPREMONLNSUBSVLOLVD1MTHAPPERU R2Z-00005 - SHRPNTONLNPLAN2OPENDAP
CW2-00270 - ENG SA OLP NL LCLGOV R2Z-00001 - SHRPNTONLNPLAN2OPENNLAP
CW2-00271 - ENG UPGRDSAPK OLP NL LCLGOV CW2-00231 - SNGL SA OLP C
76A-00324 - ENTCAL ALNG LICSAPK OLV C 1Y ENT DVCCAL CW2-00232 - SNGL SA OLP NL
76A-00326 - ENTCAL ALNG LICSAPK OLV C 1Y ENT USRCAL CW2-00019 - SNGL SA OLV NL 1Y AQY1 AP
76A-00492 - ENTCAL ALNG LICSAPK OLV C 1Y PLTFRM DVCC CW2-00035 - SNGL SA OLV NL 1Y AQY2 AP
76A-00494 - ENTCAL ALNG LICSAPK OLV C 1Y PLTFRM USRC CW2-00051 - SNGL SA OLV NL 1Y AQY3 AP
76A-00818 - ENTCAL ALNG LICSAPK OLV C 1Y PLTFRMUTD D CW2-00147 - SNGL SA OLV NL 2Y AQY2 AP
76A-00820 - ENTCAL ALNG LICSAPK OLV C 1Y PLTFRMUTD U CW2-00136 - SNGL SA OLV NL 3Y AQY1 AP
76A-00830 - ENTCAL ALNG LICSAPK OLV C 1Y UTD DVCCAL 7U6-00003 - SNGL SUBSVL OLP NL ANNUAL QLFD
76A-00832 - ENTCAL ALNG LICSAPK OLV C 1Y UTD USRCAL CW2-00233 - SNGL UPGRDSAPK OLP C
76A-00360 - ENTCAL ALNG LICSAPK OLV D 1Y ENT DVCCAL CW2-00234 - SNGL UPGRDSAPK OLP NL
76A-00361 - ENTCAL ALNG LICSAPK OLV D 1Y ENT USRCAL CW2-00020 - SNGL UPGRDSAPK OLV NL 1Y AQY1 AP
76A-00528 - ENTCAL ALNG LICSAPK OLV D 1Y PLTFRM DVCC CW2-00036 - SNGL UPGRDSAPK OLV NL 1Y AQY2 AP
76A-00529 - ENTCAL ALNG LICSAPK OLV D 1Y PLTFRM USRC CW2-00052 - SNGL UPGRDSAPK OLV NL 1Y AQY3 AP
76A-00826 - ENTCAL ALNG LICSAPK OLV D 1Y PLTFRMUTD D CW2-00148 - SNGL UPGRDSAPK OLV NL 2Y AQY2 AP
76A-00827 - ENTCAL ALNG LICSAPK OLV D 1Y PLTFRMUTD U CW2-00137 - SNGL UPGRDSAPK OLV NL 3Y AQY1 AP
76A-00838 - ENTCAL ALNG LICSAPK OLV D 1Y UTD DVCCAL VBC-00001 - SoftGrid CAL for TS 4.1 English MLP 20 Device CAL
76A-00839 - ENTCAL ALNG LICSAPK OLV D 1Y UTD USRCAL 359-01624 - SQL CAL ALL LNG LIC/SA PK OLV NL 1YR ADD
76A-00850 - ENTCAL ALNG SASU OLV C 1Y CORECAL ENT DVCCAL WSRVCS 359-01631 - SQL CAL ALL LNG LIC/SA PK OLV NL 1YR ADD
76A-00852 - ENTCAL ALNG SASU OLV C 1Y CORECAL ENT USRCAL WSRVCS 359-01466 - SQL CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL
76A-00858 - ENTCAL ALNG SASU OLV C 1Y CORECAL PLTFRM DVCCAL WSRVCS 359-01471 - SQL CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL
76A-00860 - ENTCAL ALNG SASU OLV C 1Y CORECAL PLTFRM USRCAL WSRVCS 359-01472 - SQL CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD USER CAL
76A-00866 - ENTCAL ALNG SASU OLV C 1Y CORECAL PLTFRMUTD DVCCAL WSRVCS 359-01465 - SQL CAL ENGLISH LIC/SA PACK OLV NL 2YR ACQ Y2 ADDTL PROD DEVICE CAL
76A-00868 - ENTCAL ALNG SASU OLV C 1Y CORECAL PLTFRMUTD USRCAL WSRVCS 359-01464 - SQL CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL
76A-00874 - ENTCAL ALNG SASU OLV C 1Y CORECAL UTD DVCCAL WSRVCS 359-01469 - SQL CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL
76A-00876 - ENTCAL ALNG SASU OLV C 1Y CORECAL UTD USRCAL WSRVCS 359-01474 - SQL CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL
76A-00882 - ENTCAL ALNG SASU OLV D 1Y CORECAL ENT DVCCAL WSRVCS 359-01479 - SQL CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL
76A-00883 - ENTCAL ALNG SASU OLV D 1Y CORECAL ENT USRCAL WSRVCS 359-01476 - SQL CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL
76A-00886 - ENTCAL ALNG SASU OLV D 1Y CORECAL PLTFRM DVCCAL WSRVCS 359-01481 - SQL CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL
76A-00887 - ENTCAL ALNG SASU OLV D 1Y CORECAL PLTFRM USRCAL WSRVCS 810-08880 - SQL SERVER ENTERPRISE EDITION 2012
76A-00890 - ENTCAL ALNG SASU OLV D 1Y CORECAL PLTFRMUTD DVCCAL WSRVCS 359-00814 - SQL Server For Windows Device Client Access License NA Win 2K 1 Client(s) Licens
76A-00891 - ENTCAL ALNG SASU OLV D 1Y CORECAL PLTFRMUTD USRCAL WSRVCS 359-00738 - SQL Server For Windows Device Client Access License NA Win 2K 2 Client(s) Licens
76A-00894 - ENTCAL ALNG SASU OLV D 1Y CORECAL UTD DVCCAL WSRVCS 359-00751 - SQL Server For Windows Device Client Access License Software Assurance WinNT/2K
76A-00895 - ENTCAL ALNG SASU OLV D 1Y CORECAL UTD USRCAL WSRVCS 359-00810 - SQL Server For Windows Device Client Access License Software Assurance WinNT/2K
76A-00861 - ENTCAL ALNG SASU OLV NL 1Y CORECAL 359-00820 - SQL Server For Windows Device Client Access License Software Assurance WinNT/2K
76A-00851 - ENTCAL ALNG SASU OLV NL 1Y CORECAL ENT DVCCAL WSRVCS 359-00734 - SQL Server For Windows Device Client Access License Software Assurance WinNT/2K
76A-00859 - ENTCAL ALNG SASU OLV NL 1Y CORECAL PLTFRM DVCCAL WSRVCS 810-05025 - SQL Server For Windows Enterprise Edition Software Assurance Win32 License Only
76A-00867 - ENTCAL ALNG SASU OLV NL 1Y CORECAL PLTFRMUTD DVCCAL WSRVCS 810-04964 - SQL Server For Windows Enterprise Edition Software Assurance Win32 License Only
76A-00869 - ENTCAL ALNG SASU OLV NL 1Y CORECAL PLTFRMUTD USRCAL WSRVCS 810-04977 - SQL Server For Windows Enterprise Edition Software Assurance Win32 License Only
76A-00875 - ENTCAL ALNG SASU OLV NL 1Y CORECAL UTD DVCCAL WSRVCS 228-04615 - SQL Server For Windows Standard Edition Software Assurance Win32 License Only NO
76A-00877 - ENTCAL ALNG SASU OLV NL 1Y CORECAL UTD USRCAL WSRVCS 228-04628 - SQL Server For Windows Standard Edition Software Assurance Win32 License Only NO
76A-00853 - ENTCALALNG ASUOLVNL YCORECA ENTU 228-04676 - SQL Server For Windows Standard Edition Software Assurance Win32 License Only NO
76A-00268 - ENTCALALNGLICSAPKOLVC1YAQY1ENTDV 228-04547 - SQL Server For Windows Standard Edition Software Assurance Win32 License Only NO
76A-00270 - ENTCALALNGLICSAPKOLVC1YAQY1ENTUS 228-04608 - SQL Server For Windows Standard Edition Software Assurance Win32 License Only NO
76A-00436 - ENTCALALNGLICSAPKOLVC1YAQY1PLTFRM 228-04560 - SQL Server For Windows Standard Edition Software Assurance Win32 License Only NO
76A-00438 - ENTCALALNGLICSAPKOLVC1YAQY1PLTFRM 359-01027 - SQL Server For Windows User Client Access License 2000 Win NT 1 Client(s) Licens
76A-00292 - ENTCALALNGLICSAPKOLVC1YAQY2ENTDV 359-01004 - SQL Server For Windows User Client Access License 2000 Win NT 1 Client(s) Licens
76A-00294 - ENTCALALNGLICSAPKOLVC1YAQY2ENTUS 359-01020 - SQL Server For Windows User Client Access License Software Assurance WinNT/2K 1
76A-00460 - ENTCALALNGLICSAPKOLVC1YAQY2PLTFRM 359-01028 - SQL Server For Windows User Client Access License Software Assurance WinNT/2K 1
76A-00462 - ENTCALALNGLICSAPKOLVC1YAQY2PLTFRM 359-01005 - SQL Server For Windows User Client Access License Software Assurance WinNT/2K 2
76A-00308 - ENTCALALNGLICSAPKOLVC1YAQY3ENTDV 359-00998 - SQL Server For Windows User Client Access License Software Assurance WinNT/2K 2
76A-00310 - ENTCALALNGLICSAPKOLVC1YAQY3ENTUS A5K-01726 - SQL SERVER WRKGROUP EDTN WIN32 ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 5 CLT ADDTL
76A-00476 - ENTCALALNGLICSAPKOLVC1YAQY3PLTFRM A5K-01030 - SQL SERVER WRKGROUP EDTN WIN32 ENGLISH SA OLV NL 1YR ACQ Y1 ADDTLPROD 1 PROC LIC
76A-00478 - ENTCALALNGLICSAPKOLVC1YAQY3PLTFRM 810-04921 - SQL SVR ENTERPRISE EDTN WIN32 ALL LNG LI
76A-00364 - ENTCALALNGLICSAPKOLVC2YAQY2ENTDV 810-04268 - SQL SVR ENTERPRISE EDTN WIN32 ENGLISH LIC/SA PK OLV NL 1YR ACQ Y1 ADDTLPROD1PROC
76A-00366 - ENTCALALNGLICSAPKOLVC2YAQY2ENTUS 810-04881 - SQL SVR ENTERPRISE EDTN WIN32 ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
76A-00532 - ENTCALALNGLICSAPKOLVC2YAQY2PLTFRM 810-03096 - SQL SVR ENTERPRISE EDTN WIN32 ENGLISH SA OLV NL 1YR ACQ Y1 ADDTLPROD 1 PROC LIC
76A-00534 - ENTCALALNGLICSAPKOLVC2YAQY2PLTFRM 810-04913 - SQL SVR ENTERPRISE EDTN WIN32 ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
76A-00388 - ENTCALALNGLICSAPKOLVC3YAQY1ENTDV C9C-00115 - SQL SVR FOR SMALL BUS ALL LNG LIC/SA PAC
76A-00390 - ENTCALALNGLICSAPKOLVC3YAQY1ENTUS DAC-00168 - SQL SVR FOR SMALL BUS CAL ALL LNG LIC/SA
76A-00558 - ENTCALALNGLICSAPKOLVC3YAQY1PLTFRM DAC-00169 - SQL SVR FOR SMALL BUS CAL ALL LNG LIC/SA
76A-00556 - ENTCALALNGLICSAPKOLVC3YAQY1PLTFRM DAC-00144 - SQL SVR FOR SMALL BUS CAL SNGL LIC/SA PA
76A-00332 - ENTCALALNGLICSAPKOLVD1YAQY1ENTDV DAC-00231 - SQL SVR FOR SMALL BUS CAL SNGL LIC/SA PA
76A-00333 - ENTCALALNGLICSAPKOLVD1YAQY1ENTUS DAC-00124 - SQL SVR FOR SMALL BUS CAL SNGL LIC/SA PA
76A-00500 - ENTCALALNGLICSAPKOLVD1YAQY1PLTFRM DAC-00125 - SQL SVR FOR SMALL BUS CAL SNGL LIC/SA PA
76A-00501 - ENTCALALNGLICSAPKOLVD1YAQY1PLTFRM DAC-00145 - SQL SVR FOR SMALL BUS CAL SNGL LIC/SA PA
76A-00344 - ENTCALALNGLICSAPKOLVD1YAQY2ENTDV DAC-00259 - SQL SVR FOR SMALL BUS CAL SNGL LIC/SA PA
76A-00345 - ENTCALALNGLICSAPKOLVD1YAQY2ENTUS DAC-00260 - SQL SVR FOR SMALL BUS CAL SNGL LIC/SA PA
76A-00513 - ENTCALALNGLICSAPKOLVD1YAQY2PLTFRM DAC-00230 - SQL SVR FOR SMALL BUS CAL SNGL LIC/SA PA
76A-00512 - ENTCALALNGLICSAPKOLVD1YAQY2PLTFRM DAC-00261 - SQL SVR FOR SMALL BUS CAL SNGL SA OLV NL
76A-00352 - ENTCALALNGLICSAPKOLVD1YAQY3ENTDV DAC-00146 - SQL SVR FOR SMALL BUS CAL SNGL SA OLV NL
76A-00353 - ENTCALALNGLICSAPKOLVD1YAQY3ENTUS DAC-00147 - SQL SVR FOR SMALL BUS CAL SNGL SA OLV NL
76A-00521 - ENTCALALNGLICSAPKOLVD1YAQY3PLTFRM DAC-00126 - SQL SVR FOR SMALL BUS CAL SNGL SA OLV NL
76A-00520 - ENTCALALNGLICSAPKOLVD1YAQY3PLTFRM DAC-00127 - SQL SVR FOR SMALL BUS CAL SNGL SA OLV NL
76A-00380 - ENTCALALNGLICSAPKOLVD2YAQY2ENTDV DAC-00232 - SQL SVR FOR SMALL BUS CAL SNGL SA OLV NL
76A-00381 - ENTCALALNGLICSAPKOLVD2YAQY2ENTUS DAC-00233 - SQL SVR FOR SMALL BUS CAL SNGL SA OLV NL
76A-00549 - ENTCALALNGLICSAPKOLVD2YAQY2PLTFRM DAC-00262 - SQL SVR FOR SMALL BUS CAL SNGL SA OLV NL
76A-00548 - ENTCALALNGLICSAPKOLVD2YAQY2PLTFRM C9C-00103 - SQL SVR FOR SMALL BUS SNGL LIC/SA PACK O
76A-00412 - ENTCALALNGLICSAPKOLVD3YAQY1ENTDV C9C-00147 - SQL SVR FOR SMALL BUS SNGL LIC/SA PACK O
76A-00413 - ENTCALALNGLICSAPKOLVD3YAQY1ENTUS C9C-00162 - SQL SVR FOR SMALL BUS SNGL LIC/SA PACK O
76A-00580 - ENTCALALNGLICSAPKOLVD3YAQY1PLTFRM C9C-00093 - SQL SVR FOR SMALL BUS SNGL LIC/SA PACK O
76A-00581 - ENTCALALNGLICSAPKOLVD3YAQY1PLTFRM C9C-00094 - SQL SVR FOR SMALL BUS SNGL SA OLV NL 1YR
76A-00276 - ENTCALALNGSAOLVC1YAQY1ENTDVCCAL C9C-00104 - SQL SVR FOR SMALL BUS SNGL SA OLV NL 1YR
76A-00278 - ENTCALALNGSAOLVC1YAQY1ENTUSRCAL C9C-00148 - SQL SVR FOR SMALL BUS SNGL SA OLV NL 2YR
76A-00444 - ENTCALALNGSAOLVC1YAQY1PLTFRMDVCC C9C-00163 - SQL SVR FOR SMALL BUS SNGL SA OLV NL 3YR
76A-00446 - ENTCALALNGSAOLVC1YAQY1PLTFRMUSRC 228-09176 - SQL SVR STANDARD EDTN 2008 R2 32-BIT/X64 ENGLISH AE DVD 10 CLT
76A-00396 - ENTCALALNGSAOLVC3YAQY1ENTDVCCAL 228-04735 - SQL SVR STANDARD EDTN WIN32 ALL LNG LIC/
76A-00398 - ENTCALALNGSAOLVC3YAQY1ENTUSRCAL 228-04738 - SQL SVR STANDARD EDTN WIN32 ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
76A-00564 - ENTCALALNGSAOLVC3YAQY1PLTFRMDVCC 228-04748 - SQL SVR STANDARD EDTN WIN32 ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD
76A-00566 - ENTCALALNGSAOLVC3YAQY1PLTFRMUSRC 228-04778 - SQL SVR STANDARD EDTN WIN32 ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
76A-00336 - ENTCALALNGSAOLVD1YAQY1ENTDVCCAL 228-05177 - SQL SVR STANDARD EDTN WIN32 ENGLISH LIC/SA PK OLV NL 1YR ACQ Y1 ADDTLPROD 1 PROC
76A-00337 - ENTCALALNGSAOLVD1YAQY1ENTUSRCAL 228-04685 - SQL SVR STANDARD EDTN WIN32 ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
76A-00504 - ENTCALALNGSAOLVD1YAQY1PLTFRMDVCC 228-05125 - SQL SVR STANDARD EDTN WIN32 ENGLISH SA OLV NL 1YR ACQ Y1 ADDTLPROD 1 PROC LIC
76A-00505 - ENTCALALNGSAOLVD1YAQY1PLTFRMUSRC 228-04725 - SQL SVR STANDARD EDTN WIN32 ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
76A-00416 - ENTCALALNGSAOLVD3YAQY1ENTDVCCAL TFA-00065 - SQL SVR WEB ED SNGL LIC/SA PACK OLV NL 1
76A-00417 - ENTCALALNGSAOLVD3YAQY1ENTUSRCAL A5M-00718 - SQL WORKGROUP CAL WIN32 ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD USER CA
76A-00584 - ENTCALALNGSAOLVD3YAQY1PLTFRMDVCC 359-05664 - SQLCAL 2012 ALNG OLV NL EACH AP USRCAL
76A-00585 - ENTCALALNGSAOLVD3YAQY1PLTFRMUSRC 359-05717 - SQLCAL 2012 SNGL OLP NL USRCAL
76A-00274 - ENTCALALNGSASUOLVC1YAQY1CORECALE 359-06125 - SQLCAL 2014 ENG OLP NL LCLGOV DVCCAL
76A-00272 - ENTCALALNGSASUOLVC1YAQY1CORECALE 359-06126 - SQLCAL 2014 ENG OLP NL LCLGOV USRCAL
76A-00440 - ENTCALALNGSASUOLVC1YAQY1CORECALP 359-06095 - SQLCAL 2014 SNGL OLP C DVCCAL
76A-00442 - ENTCALALNGSASUOLVC1YAQY1CORECALP 359-06097 - SQLCAL 2014 SNGL OLP C USRCAL
76A-00298 - ENTCALALNGSASUOLVC1YAQY2CORECALE 359-06096 - SQLCAL 2014 SNGL OLP NL DVCCAL
76A-00296 - ENTCALALNGSASUOLVC1YAQY2CORECALE 359-06098 - SQLCAL 2014 SNGL OLP NL USRCAL
76A-00466 - ENTCALALNGSASUOLVC1YAQY2CORECALP 359-05174 - SQLCAL ALNG LICSAPK OLV C 1Y AP DVCCAL
76A-00464 - ENTCALALNGSASUOLVC1YAQY2CORECALP 359-05175 - SQLCAL ALNG LICSAPK OLV C 1Y AP USRCAL
76A-00314 - ENTCALALNGSASUOLVC1YAQY3CORECALE 359-04628 - SQLCAL ALNG LICSAPK OLV D 1Y AP DVCCAL
76A-00312 - ENTCALALNGSASUOLVC1YAQY3CORECALE 359-04630 - SQLCAL ALNG LICSAPK OLV D 1Y AP USRCAL
76A-00482 - ENTCALALNGSASUOLVC1YAQY3CORECALP 359-01467 - SQLCALENGLISHLIC/SAPACKOLVNL1YRACQY2ADDT
76A-00480 - ENTCALALNGSASUOLVC1YAQY3CORECALP 359-01468 - SQLCALENGLISHLIC/SAPACKOLVNL1YRACQY3ADDT
76A-00368 - ENTCALALNGSASUOLVC2YAQY2CORECALE 359-01473 - SQLCALENGLISHLIC/SAPACKOLVNL1YRACQY3ADDT
76A-00370 - ENTCALALNGSASUOLVC2YAQY2CORECALE 359-01470 - SQLCALENGLISHLIC/SAPACKOLVNL2YRACQY2ADDT
76A-00536 - ENTCALALNGSASUOLVC2YAQY2CORECALP 359-01478 - SQLCALENGLISHSAOLVNL1YRACQY2ADDTLPRODDEV
76A-00538 - ENTCALALNGSASUOLVC2YAQY2CORECALP 359-01483 - SQLCALENGLISHSAOLVNL1YRACQY2ADDTLPRODUSE
76A-00394 - ENTCALALNGSASUOLVC3YAQY1CORECALE 359-01477 - SQLCALENGLISHSAOLVNL1YRACQY3ADDTLPRODDEV
76A-00392 - ENTCALALNGSASUOLVC3YAQY1CORECALE 359-01482 - SQLCALENGLISHSAOLVNL1YRACQY3ADDTLPRODUSE
76A-00560 - ENTCALALNGSASUOLVC3YAQY1CORECALP 359-01475 - SQLCALENGLISHSAOLVNL2YRACQY2ADDTLPRODDEV
76A-00562 - ENTCALALNGSASUOLVC3YAQY1CORECALP 359-01480 - SQLCALENGLISHSAOLVNL2YRACQY2ADDTLPRODUSE
76A-00334 - ENTCALALNGSASUOLVD1YAQY1CORECALE 359-04610 - SQLCALLICSAPKOLVD1YAQY1APDVCCAL
76A-00335 - ENTCALALNGSASUOLVD1YAQY1CORECALE 359-04615 - SQLCALLICSAPKOLVD1YAQY1APUSRCAL
76A-00503 - ENTCALALNGSASUOLVD1YAQY1CORECALP 359-04611 - SQLCALLICSAPKOLVD1YAQY2APDVCCAL
76A-00347 - ENTCALALNGSASUOLVD1YAQY2CORECALE 359-04616 - SQLCALLICSAPKOLVD1YAQY2APUSRCAL
76A-00346 - ENTCALALNGSASUOLVD1YAQY2CORECALE 359-04612 - SQLCALLICSAPKOLVD1YAQY3APDVCCAL
76A-00514 - ENTCALALNGSASUOLVD1YAQY2CORECALP 359-04617 - SQLCALLICSAPKOLVD1YAQY3APUSRCAL
76A-00515 - ENTCALALNGSASUOLVD1YAQY2CORECALP 359-04609 - SQLCALLICSAPKOLVD2YAQY2APDVCCAL
76A-00355 - ENTCALALNGSASUOLVD1YAQY3CORECALE 359-04614 - SQLCALLICSAPKOLVD2YAQY2APUSRCAL
76A-00354 - ENTCALALNGSASUOLVD1YAQY3CORECALE 359-04608 - SQLCALLICSAPKOLVD3YAQY1APDVCCAL
76A-00522 - ENTCALALNGSASUOLVD1YAQY3CORECALP 359-04613 - SQLCALLICSAPKOLVD3YAQY1APUSRCAL
76A-00523 - ENTCALALNGSASUOLVD1YAQY3CORECALP 359-04618 - SQLCALSAOLVD1YAQY1APDVCCAL
76A-00382 - ENTCALALNGSASUOLVD2YAQY2CORECALE 359-04623 - SQLCALSAOLVD1YAQY1APUSRCAL
76A-00383 - ENTCALALNGSASUOLVD2YAQY2CORECALE 359-04622 - SQLCALSAOLVD1YAQY2APDVCCAL
76A-00551 - ENTCALALNGSASUOLVD2YAQY2CORECALP 359-04627 - SQLCALSAOLVD1YAQY2APUSRCAL
76A-00550 - ENTCALALNGSASUOLVD2YAQY2CORECALP 359-04621 - SQLCALSAOLVD1YAQY3APDVCCAL
76A-00415 - ENTCALALNGSASUOLVD3YAQY1CORECALE 359-04626 - SQLCALSAOLVD1YAQY3APUSRCAL
76A-00414 - ENTCALALNGSASUOLVD3YAQY1CORECALE 359-04619 - SQLCALSAOLVD2YAQY2APDVCCAL
76A-00583 - ENTCALALNGSASUOLVD3YAQY1CORECALP 359-04624 - SQLCALSAOLVD2YAQY2APUSRCAL
76A-00582 - ENTCALALNGSASUOLVD3YAQY1CORECALP 359-04620 - SQLCALSAOLVD3YAQY1APDVCCAL
76A-00770 - ENTCALLICSAPKOLVD1YAQY1APDVCCALW 359-04625 - SQLCALSAOLVD3YAQY1APUSRCAL
76A-00771 - ENTCALLICSAPKOLVD1YAQY1APUSRCALW 359-05130 - SQLCALSNGLLICSAPKOLVC1YAQY1APDVC
76A-00776 - ENTCALLICSAPKOLVD1YAQY2APDVCCALW 359-05131 - SQLCALSNGLLICSAPKOLVC1YAQY1APUSR
76A-00777 - ENTCALLICSAPKOLVD1YAQY2APUSRCALW 359-05150 - SQLCALSNGLLICSAPKOLVC1YAQY2APDVC
76A-00782 - ENTCALLICSAPKOLVD1YAQY3APDVCCALW 359-05151 - SQLCALSNGLLICSAPKOLVC1YAQY2APUSR
76A-00783 - ENTCALLICSAPKOLVD1YAQY3APUSRCALW 359-05170 - SQLCALSNGLLICSAPKOLVC1YAQY3APDVC
76A-00788 - ENTCALLICSAPKOLVD2YAQY2APDVCCALW 359-05171 - SQLCALSNGLLICSAPKOLVC1YAQY3APUSR
76A-00789 - ENTCALLICSAPKOLVD2YAQY2APUSRCALW 359-05192 - SQLCALSNGLLICSAPKOLVC2YAQY2APDVC
76A-00794 - ENTCALLICSAPKOLVD3YAQY1APDVCCALW 359-05193 - SQLCALSNGLLICSAPKOLVC2YAQY2APUSR
76A-00795 - ENTCALLICSAPKOLVD3YAQY1APUSRCALW 359-05212 - SQLCALSNGLLICSAPKOLVC3YAQY1APDVC
76A-00774 - ENTCALSAOLVD1YAQY1APDVCCALWSRVCS 359-05213 - SQLCALSNGLLICSAPKOLVC3YAQY1APUSR
76A-00775 - ENTCALSAOLVD1YAQY1APUSRCALWSRVCS 359-05132 - SQLCALSNGLSAOLVC1YAQY1APDVCCAL
76A-00780 - ENTCALSAOLVD1YAQY2APDVCCALWSRVCS 359-05133 - SQLCALSNGLSAOLVC1YAQY1APUSRCAL
76A-00781 - ENTCALSAOLVD1YAQY2APUSRCALWSRVCS 359-05152 - SQLCALSNGLSAOLVC1YAQY2APDVCCAL
76A-00786 - ENTCALSAOLVD1YAQY3APDVCCALWSRVCS 359-05153 - SQLCALSNGLSAOLVC1YAQY2APUSRCAL
76A-00787 - ENTCALSAOLVD1YAQY3APUSRCALWSRVCS 359-05172 - SQLCALSNGLSAOLVC1YAQY3APDVCCAL
76A-00792 - ENTCALSAOLVD2YAQY2APDVCCALWSRVCS 359-05173 - SQLCALSNGLSAOLVC1YAQY3APUSRCAL
76A-00793 - ENTCALSAOLVD2YAQY2APUSRCALWSRVCS 359-05194 - SQLCALSNGLSAOLVC2YAQY2APDVCCAL
76A-00798 - ENTCALSAOLVD3YAQY1APDVCCALWSRVCS 359-05195 - SQLCALSNGLSAOLVC2YAQY2APUSRCAL
76A-00799 - ENTCALSAOLVD3YAQY1APUSRCALWSRVCS 359-05214 - SQLCALSNGLSAOLVC3YAQY1APDVCCAL
76A-00772 - ENTCALSASUOLVD1YAQY1CORECALAPDVC 359-05215 - SQLCALSNGLSAOLVC3YAQY1APUSRCAL
76A-00773 - ENTCALSASUOLVD1YAQY1CORECALAPUSR Z9Z-00010 - SQLPWRBIOPEN ANNUAL PROMO QLFD
76A-00778 - ENTCALSASUOLVD1YAQY2CORECALAPDVC Z9Z-00002 - SQLPWRBIOPEN 1MTH AP
76A-00779 - ENTCALSASUOLVD1YAQY2CORECALAPUSR Z9Z-00009 - SQLPWRBIOPEN 1MTH AP PROMO
76A-00784 - ENTCALSASUOLVD1YAQY3CORECALAPDVC Z9Z-00014 - SQLPWRBIOPEN ANNUAL LCLGOV PROMO QLFD
76A-00785 - ENTCALSASUOLVD1YAQY3CORECALAPUSR Z9Z-00007 - SQLPWRBIOPEN ANNUAL LCLGOV QLFD
76A-00790 - ENTCALSASUOLVD2YAQY2CORECALAPDVC Z9Z-00003 - SQLPWRBIOPEN OLP NL ANNUAL QLFD
76A-00791 - ENTCALSASUOLVD2YAQY2CORECALAPUSR Z9Z-00004-12 - SQLPWRBIOPEN OLV D 1MTH AP
76A-00796 - ENTCALSASUOLVD3YAQY1CORECALAPDVC Z9Z-00011-12 - SQLPWRBIOPEN OLV D 1MTH AP PROMO
76A-00797 - ENTCALSASUOLVD3YAQY1CORECALAPUSR Z9Z-00012 - SQLPWRBIOPEN OLV D 1MTH AP PROMO
7JQ-00773 - ENTCORE 2014 ENG2LIC NL LCLGOV CORELIC Z9Z-00001-12 - SQLPWRBIOPEN OLV NL 1MTH AP
7JQ-00751 - ENTCORE 2014 SNGL2LIC NL CORELIC QLFD Z9Z-00008-12 - SQLPWRBIOPEN OLV NL 1MTH AP PROMO
76A-00437 - ENTERPRISE CAL ALL LNG L/SA PACK OLV NL Z9Z-00005 - SQLPWRBIOPEN SUBSVL OLV D 1MTH AP
76A-00439 - ENTERPRISE CAL ALL LNG L/SA PACK OLV NL A5K-01400 - SQLSERVERWRKGROUPEDTNWIN32ENGLISHSAOLVNL
76A-00461 - ENTERPRISE CAL ALL LNG L/SA PACK OLV NL 7JQ-00416 - SQLSVR SASU OLV 2LIC 1Y SLSVRSTD CRELIC
76A-00557 - ENTERPRISE CAL ALL LNG L/SA PACK OLV NL 7JQ-00415 - SQLSVR SASU OLV 2LIC C 1Y VRSTD CRELIC
76A-00559 - ENTERPRISE CAL ALL LNG L/SA PACK OLV NL 7JQ-00423 - SQLSVR SASU OLV 2LIC D1Y SLSVRSTD CRELIC
76A-00535 - ENTERPRISE CAL ALL LNG L/SA PACK OLV NL 7JQ-00088 - SQLSVRALNG LICSAPK OLV 2LIC 1Y AP CRELIC
76A-00533 - ENTERPRISE CAL ALL LNG L/SA PACK OLV NL 7JQ-00077 - SQLSVRALNG LICSK OLV 2LIC C 1Y CRELIC
76A-00463 - ENTERPRISE CAL ALL LNG L/SA PACK OLV NL 7JQ-00129 - SQLSVRALNG LICSK OLV 2LIC D 1Y CRELIC
76A-00833 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV D2M-00361 - SQLSVRBSNSSINTEL LICSAPK OLP NL LCLGOV
76A-00831 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV D2M-00405 - SQLSVRBSNSSINTEL SNGL LICSAPK OLP C
76A-00327 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N D2M-00406 - SQLSVRBSNSSINTEL SNGL LICSAPK OLP NL
76A-00295 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N D2M-00356 - SQLSVRBSNSSINTEL SNGL SA OLP NL CHRTY
76A-00325 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N D2M-00666 - SQLSVRBSNSSINTELLIGENCE 2014 SNGL OLP C
76A-00493 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N D2M-00667 - SQLSVRBSNSSINTELLIGENCE 2014 SNGLNL QLFD
76A-00495 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N D2M-00407 - SQLSVRBSNSSINTELLIGENCE SNGL SA OLP C
76A-00367 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N D2M-00408 - SQLSVRBSNSSINTELLIGENCE SNGL SA OLP NL
76A-00389 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N USD-00004 - SQLSVRDATACTR 2008R2 ENG DISKKIT MVL DVD
76A-00391 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N 77D-00070 - SQLSVRDATACTR SASU OLV D 1Y AQY1
76A-00271 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N 77D-00071 - SQLSVRDATACTR SASU OLV D 1Y AQY2
76A-00293 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N 77D-00072 - SQLSVRDATACTR SASU OLV D 1Y AQY3
76A-00365 - ENTERPRISE CAL ALL LNG LIC/SA PACK OLV N 77D-00058 - SQLSVRDATACTR SASU OLV D 2Y AQY2
76A-00821 - ENTERPRISE CAL ALL LNG LSA PACK OLV NL 77D-00075 - SQLSVRDATACTR SASU OLV D 3Y AQY1
76A-00819 - ENTERPRISE CAL ALL LNG LSA PACK OLV NL 77D-00050 - SQLSVRDATACTR SNGL SASU OLV C 1Y AQY1
76A-00593 - ENTERPRISE CAL ALL LNG OLV NL EACH PLATF 77D-00054 - SQLSVRDATACTR SNGL SASU OLV C 1Y AQY2
76A-00277 - ENTERPRISE CAL ALL LNG SA OLV NL 1YR ACQ 77D-00059 - SQLSVRDATACTR SNGL SASU OLV C 1Y AQY3
76A-00279 - ENTERPRISE CAL ALL LNG SA OLV NL 1YR ACQ 77D-00056 - SQLSVRDATACTR SNGL SASU OLV C 2Y AQY2
76A-00445 - ENTERPRISE CAL ALL LNG SA OLV NL 1YR ACQ 77D-00073 - SQLSVRDATACTR SNGL SASU OLV C 3Y AQY1
76A-00447 - ENTERPRISE CAL ALL LNG SA OLV NL 1YR ACQ 77D-00051 - SQLSVRDATACTR SNGL SASU OLV NL 1Y AQY1
76A-00567 - ENTERPRISE CAL ALL LNG SA OLV NL 3YR ACQ 77D-00055 - SQLSVRDATACTR SNGL SASU OLV NL 1Y AQY2
76A-00565 - ENTERPRISE CAL ALL LNG SA OLV NL 3YR ACQ 77D-00069 - SQLSVRDATACTR SNGL SASU OLV NL 1Y AQY3
76A-00397 - ENTERPRISE CAL ALL LNG SA OLV NL 3YR ACQ 77D-00057 - SQLSVRDATACTR SNGL SASU OLV NL 2Y AQY2
76A-00399 - ENTERPRISE CAL ALL LNG SA OLV NL 3YR ACQ 77D-00074 - SQLSVRDATACTR SNGL SASU OLV NL 3Y AQY1
76A-00297 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL E32-01180 - SQLSVRDEV 2014 ENG OLP NL LCLGOV
76A-00465 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL E32-01165 - SQLSVRDEV 2014 SNGL OLP C
76A-00467 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL E32-01166 - SQLSVRDEV 2014 SNGL OLP NL
76A-00561 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 810-08218 - SQLSVRENT 2008R2 GER DISKKIT MVL DVD
76A-00563 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 810-08920 - SQLSVRENT 2014 ENG DISKKIT MVL DVD
76A-00273 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 7JQ-00004 - SQLSVRENTCORE 2012 ENG DISKKIT MVL DVD
76A-00275 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 7JQ-00672 - SQLSVRENTCORE 2014 ENG DISKKIT MVL DVD
76A-00369 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 7JQ-00750 - SQLSVRENTCORE 2014 SNGL2LIC C CORELIC
76A-00371 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 7JQ-00254 - SQLSVRENTCORE SNGL SA OLP 2LIC C CORELIC
76A-00299 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 810-04889 - SQLSVRENTERPRISEEDTNWIN32ENGLISHSAOLVNL1
76A-00393 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 810-04897 - SQLSVRENTERPRISEEDTNWIN32ENGLISHSAOLVNL1
76A-00395 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 810-04905 - SQLSVRENTERPRISEEDTNWIN32ENGLISHSAOLVNL2
76A-00441 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 7JQ-00336 - SQLSVRENTLICSAPK OLP 2LIC LCLGOV CORELIC
76A-00443 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 7JQ-00337 - SQLSVRENTSA OLP 2LIC NL LCLGOV CORELIC
76A-00537 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 810-06376 - SQLSVRENTSAOLVD1YAQY1AP
76A-00539 - ENTERPRISE CAL ALL LNG SA STEP UP OLV NL 810-06377 - SQLSVRENTSAOLVD1YAQY2AP
76A-00616 - ENTERPRISE CAL SNGL LSA PACK OLV NL 1YR 810-06378 - SQLSVRENTSAOLVD1YAQY3AP
76A-00617 - ENTERPRISE CAL SNGL LSA PACK OLV NL 1YR 810-06379 - SQLSVRENTSAOLVD2YAQY2AP
76A-00634 - ENTERPRISE CAL SNGL LSA PACK OLV NL 1YR 810-06380 - SQLSVRENTSAOLVD3YAQY1AP
76A-00635 - ENTERPRISE CAL SNGL LSA PACK OLV NL 1YR 7JQ-00252 - SQLSVRENTSNGL LICSAPK OLP 2LIC C CORELIC
76A-00714 - ENTERPRISE CAL SNGL LSA PACK OLV NL 2YR 7JQ-00253 - SQLSVRENTSNGL LICSAPK OLP 2LIC CORELIC
76A-00715 - ENTERPRISE CAL SNGL LSA PACK OLV NL 2YR 7JQ-00255 - SQLSVRENTSNGL SA OLP 2LIC NL CORELIC
76A-00744 - ENTERPRISE CAL SNGL LSA PACK OLV NL 3YR 810-07865 - SQLSVRENTSNGLSAOLVC1YAQY1AP
76A-00745 - ENTERPRISE CAL SNGL LSA PACK OLV NL 3YR 810-07895 - SQLSVRENTSNGLSAOLVC1YAQY2AP
76A-00621 - ENTERPRISE CAL SNGL SA OLV NL 1YR ACQ Y1 810-07925 - SQLSVRENTSNGLSAOLVC1YAQY3AP
76A-00620 - ENTERPRISE CAL SNGL SA OLV NL 1YR ACQ Y1 810-07957 - SQLSVRENTSNGLSAOLVC2YAQY2AP
76A-00638 - ENTERPRISE CAL SNGL SA OLV NL 1YR ACQ Y2 810-07987 - SQLSVRENTSNGLSAOLVC3YAQY1AP
76A-00639 - ENTERPRISE CAL SNGL SA OLV NL 1YR ACQ Y2 C9C-00395 - SQLSVRFORSB ALNG LICSAPK OLV C 1Y AP
76A-00718 - ENTERPRISE CAL SNGL SA OLV NL 2YR ACQ Y2 C9C-00130 - SQLSVRFORSB ALNG LICSAPK OLV D 1Y AP
76A-00719 - ENTERPRISE CAL SNGL SA OLV NL 2YR ACQ Y2 DAC-00783 - SQLSVRFORSBCAL ALNG LICSAPK OLV C 1Y AP
76A-00748 - ENTERPRISE CAL SNGL SA OLV NL 3YR ACQ Y1 DAC-00782 - SQLSVRFORSBCAL ALNG LICSAPK OLV C 1Y AP
76A-00749 - ENTERPRISE CAL SNGL SA OLV NL 3YR ACQ Y1 DAC-00196 - SQLSVRFORSBCAL ALNG LICSAPK OLV D 1Y AP
76A-00636 - ENTERPRISE CAL SNGL SA STEP UP OLV NL 1Y DAC-00197 - SQLSVRFORSBCAL ALNG LICSAPK OLV D 1Y AP
76A-00637 - ENTERPRISE CAL SNGL SA STEP UP OLV NL 1Y DAC-00184 - SQLSVRFORSBCALLICSAPKOLVD1YAQY2AP
76A-00618 - ENTERPRISE CAL SNGL SA STEP UP OLV NL 1Y DAC-00185 - SQLSVRFORSBCALLICSAPKOLVD1YAQY2AP
76A-00619 - ENTERPRISE CAL SNGL SA STEP UP OLV NL 1Y DAC-00193 - SQLSVRFORSBCALLICSAPKOLVD1YAQY3AP
76A-00717 - ENTERPRISE CAL SNGL SA STEP UP OLV NL 2Y DAC-00192 - SQLSVRFORSBCALLICSAPKOLVD1YAQY3AP
76A-00716 - ENTERPRISE CAL SNGL SA STEP UP OLV NL 2Y DAC-00240 - SQLSVRFORSBCALLICSAPKOLVD2YAQY2AP
76A-00746 - ENTERPRISE CAL SNGL SA STEP UP OLV NL 3Y DAC-00239 - SQLSVRFORSBCALLICSAPKOLVD2YAQY2AP
76A-00747 - ENTERPRISE CAL SNGL SA STEP UP OLV NL 3Y DAC-00268 - SQLSVRFORSBCALLICSAPKOLVD3YAQY1AP
R4T-00009 - EQUIP YOURSELF FOR UNIVERSITY WITH THE OFFICE THAT ROAMS WITH YOU. YOUR DOCUMENT DAC-00269 - SQLSVRFORSBCALLICSAPKOLVD3YAQY1AP
065-07515 - EXCEL 2013 32-BIT/X64 ENGLISH MEDIALESS DAC-00186 - SQLSVRFORSBCALSAOLVD1YAQY2APDVCCA
065-07648 - EXCEL 2013 32-BT/X64 EGSH MDLSS NONCOCAL DAC-00187 - SQLSVRFORSBCALSAOLVD1YAQY2APUSRCA
065-08154 - EXCEL 2013 ENG OLP NL LCLGOV DAC-00194 - SQLSVRFORSBCALSAOLVD1YAQY3APDVCCA
AAA-01350 - EXCEL 2013 EXPLORE AND VISUALIZE YOUR DATA AT NEW DEPTHS IN LESS TIME DAC-00195 - SQLSVRFORSBCALSAOLVD1YAQY3APUSRCA
AAA-01268 - EXCEL 2013 EXPLORE AND VISUALIZE YOUR DATA AT NEW DEPTHS IN LESS TIME DAC-00241 - SQLSVRFORSBCALSAOLVD2YAQY2APDVCCA
065-08132 - EXCEL 2013 SNGL OLP C DAC-00242 - SQLSVRFORSBCALSAOLVD2YAQY2APUSRCA
065-08133 - EXCEL 2013 SNGL OLP NL DAC-00270 - SQLSVRFORSBCALSAOLVD3YAQY1APDVCCA
065-04766 - EXCEL ALL LNG LIC/SA PK OLV NL 1YR ADDTL DAC-00271 - SQLSVRFORSBCALSAOLVD3YAQY1APUSRCA
065-06861 - EXCEL ALNG LICSAPK OLV C 1Y AP DAC-00779 - SQLSVRFORSBCALSNGLLICSAPKOLVC1YAQY
065-06444 - EXCEL ALNG LICSAPK OLV D 1Y AP DAC-00739 - SQLSVRFORSBCALSNGLLICSAPKOLVC1YAQY
065-04594 - EXCEL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD DAC-00778 - SQLSVRFORSBCALSNGLLICSAPKOLVC1YAQY
065-04598 - EXCEL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD DAC-00758 - SQLSVRFORSBCALSNGLLICSAPKOLVC1YAQY
065-04599 - EXCEL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD DAC-00738 - SQLSVRFORSBCALSNGLLICSAPKOLVC1YAQY
065-04603 - EXCEL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD DAC-00759 - SQLSVRFORSBCALSNGLLICSAPKOLVC1YAQY
D46-00224 - Excel For MAC Standard Edition Software Assurance MAC License Only NO MEDIA INCL DAC-00800 - SQLSVRFORSBCALSNGLLICSAPKOLVC2YAQY
D46-00228 - Excel For MAC Standard Edition Software Assurance MAC License Only NO MEDIA INCL DAC-00801 - SQLSVRFORSBCALSNGLLICSAPKOLVC2YAQY
D46-00263 - Excel For MAC Standard Edition Software Assurance MAC License Only NO MEDIA INCL DAC-00821 - SQLSVRFORSBCALSNGLLICSAPKOLVC3YAQY
D46-00266 - Excel For MAC Standard Edition Software Assurance MAC License Only NO MEDIA INCL DAC-00820 - SQLSVRFORSBCALSNGLLICSAPKOLVC3YAQY
D46-00221 - Excel For MAC Standard Edition Software Assurance MAC License Only NO MEDIA INCL DAC-00741 - SQLSVRFORSBCALSNGLSAOLVC1YAQY1AP
D46-00268 - Excel For MAC Standard Edition Software Assurance MAC License Only NO MEDIA INCL DAC-00740 - SQLSVRFORSBCALSNGLSAOLVC1YAQY1AP
065-03435 - Excel For Windows Standard Edition Software Assurance 32-Bit Win License Only NO DAC-00761 - SQLSVRFORSBCALSNGLSAOLVC1YAQY2AP
065-03586 - Excel For Windows Standard Edition Software Assurance 32-Bit Win License Only NO DAC-00760 - SQLSVRFORSBCALSNGLSAOLVC1YAQY2AP
065-03367 - Excel For Windows Standard Edition Software Assurance 32-Bit Win License Only NO DAC-00781 - SQLSVRFORSBCALSNGLSAOLVC1YAQY3AP
065-03540 - Excel For Windows Standard Edition Software Assurance 32-Bit Win License Only NO DAC-00780 - SQLSVRFORSBCALSNGLSAOLVC1YAQY3AP
065-03345 - Excel For Windows Standard Edition Software Assurance 32-Bit Win License Only NO DAC-00803 - SQLSVRFORSBCALSNGLSAOLVC2YAQY2AP
065-03527 - Excel For Windows Standard Edition Software Assurance 32-Bit Win License Only NO DAC-00802 - SQLSVRFORSBCALSNGLSAOLVC2YAQY2AP
D46-00803 - EXCEL MAC 2011 ENGLISH DVD DAC-00822 - SQLSVRFORSBCALSNGLSAOLVC3YAQY1AP
D46-00525 - EXCEL MAC ALL LNG LIC/SA PK OLV NL 1YR A DAC-00823 - SQLSVRFORSBCALSNGLSAOLVC3YAQY1AP
D46-00487 - EXCEL MAC ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD C9C-00124 - SQLSVRFORSBLICSAPKOLVD1YAQY2AP
D46-00485 - EXCEL MAC ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD C9C-00128 - SQLSVRFORSBLICSAPKOLVD1YAQY3AP
D46-00490 - EXCEL MAC ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD C9C-00152 - SQLSVRFORSBLICSAPKOLVD2YAQY2AP
D46-00492 - EXCEL MAC ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD C9C-00167 - SQLSVRFORSBLICSAPKOLVD3YAQY1AP
065-04595 - EXCELENGLISHLIC/SAPACKOLVNL1YRACQY2ADDTL C9C-00125 - SQLSVRFORSBSAOLVD1YAQY2AP
065-04597 - EXCELENGLISHLIC/SAPACKOLVNL2YRACQY2ADDTL C9C-00129 - SQLSVRFORSBSAOLVD1YAQY3AP
065-04601 - EXCELENGLISHSAOLVNL1YRACQY2ADDTLPROD C9C-00153 - SQLSVRFORSBSAOLVD2YAQY2AP
065-04602 - EXCELENGLISHSAOLVNL2YRACQY2ADDTLPROD C9C-00168 - SQLSVRFORSBSAOLVD3YAQY1AP
065-06434 - EXCELLICSAPKOLVD1YAQY1AP C9C-00373 - SQLSVRFORSBSNGLLICSAPKOLVC1YAQY1A
065-06435 - EXCELLICSAPKOLVD1YAQY2AP C9C-00383 - SQLSVRFORSBSNGLLICSAPKOLVC1YAQY2A
065-06436 - EXCELLICSAPKOLVD1YAQY3AP C9C-00393 - SQLSVRFORSBSNGLLICSAPKOLVC1YAQY3A
065-06437 - EXCELLICSAPKOLVD2YAQY2AP C9C-00404 - SQLSVRFORSBSNGLLICSAPKOLVC2YAQY2A
065-06438 - EXCELLICSAPKOLVD3YAQY1AP C9C-00414 - SQLSVRFORSBSNGLLICSAPKOLVC3YAQY1A
D46-00789 - EXCELMAC ALNG LICSAPK OLV C 1Y AP C9C-00374 - SQLSVRFORSBSNGLSAOLVC1YAQY1AP
D46-00591 - EXCELMAC ALNG LICSAPK OLV D 1Y AP C9C-00384 - SQLSVRFORSBSNGLSAOLVC1YAQY2AP
D46-00488 - EXCELMACENGLISHLIC/SAPACKOLVNL1YRACQY2AD C9C-00394 - SQLSVRFORSBSNGLSAOLVC1YAQY3AP
D46-00486 - EXCELMACENGLISHLIC/SAPACKOLVNL2YRACQY2AD C9C-00405 - SQLSVRFORSBSNGLSAOLVC2YAQY2AP
D46-00494 - EXCELMACENGLISHSAOLVNL1YRACQY2ADDTLPROD C9C-00415 - SQLSVRFORSBSNGLSAOLVC3YAQY1AP
D46-00491 - EXCELMACENGLISHSAOLVNL2YRACQY2ADDTLPROD D2M-00217 - SQLSVRINTEL ALNG LICSAPK OLV C 1Y AP
D46-00584 - EXCELMACLICSAPKOLVD1YAQY2AP D2M-00269 - SQLSVRINTEL ALNG LICSAPK OLV D 1Y AP
D46-00585 - EXCELMACLICSAPKOLVD1YAQY3AP D2M-00218 - SQLSVRINTEL ALNG LICSAPK OLV NL 1Y AP
D46-00582 - EXCELMACLICSAPKOLVD2YAQY2AP D2M-00466 - SQLSVRINTEL ALNG SASU OLV 1Y SQLSVRSTD
D46-00590 - EXCELMACSAOLVD1YAQY2AP D2M-00465 - SQLSVRINTEL ALNG SASU OLV C 1Y SQLSVRSD
D46-00589 - EXCELMACSAOLVD1YAQY3AP D2M-00473 - SQLSVRINTEL ALNG SASU OLV D 1Y SQLSVRSD
D46-00587 - EXCELMACSAOLVD2YAQY2AP D2M-00350 - SQLSVRINTEL SNGL LICSAPK OLP NL ACDMC
D46-00588 - EXCELMACSAOLVD3YAQY1AP D2M-00355 - SQLSVRINTEL SNGL LICSAPK OLP NL CHRTY
D46-00775 - EXCELMACSNGLLICSAPKOLVC1YAQY1AP 7NQ-00637 - SQLSVRSTANDARDCORE 2012
D46-00781 - EXCELMACSNGLLICSAPKOLVC1YAQY2AP 228-04695 - SQLSVRSTANDARDEDTNWIN32ENGLISHSAOLVNL1YR
D46-00787 - EXCELMACSNGLLICSAPKOLVC1YAQY3AP 228-04705 - SQLSVRSTANDARDEDTNWIN32ENGLISHSAOLVNL1YR
D46-00794 - EXCELMACSNGLLICSAPKOLVC2YAQY2AP 228-04715 - SQLSVRSTANDARDEDTNWIN32ENGLISHSAOLVNL2YR
D46-00800 - EXCELMACSNGLLICSAPKOLVC3YAQY1AP 228-04758 - SQLSVRSTANDEDTNWIN32ENGLISHLIC/SAOLVNL1Y
D46-00776 - EXCELMACSNGLSAOLVC1YAQY1AP 228-04768 - SQLSVRSTANDEDTNWIN32ENGLISHLIC/SAOLVNL2Y
D46-00782 - EXCELMACSNGLSAOLVC1YAQY2AP 228-09168 - SQLSVRSTD 2008R2 GER DISKKIT MVL DVD
D46-00788 - EXCELMACSNGLSAOLVC1YAQY3AP 228-09864 - SQLSVRSTD 2012 ALNG OLV NL EACH AP
D46-00795 - EXCELMACSNGLSAOLVC2YAQY2AP 228-09884 - SQLSVRSTD 2012 SNGL OLP NL
D46-00801 - EXCELMACSNGLSAOLVC3YAQY1AP 228-10265 - SQLSVRSTD 2014 ENG DISKKIT MVL DVD
065-06439 - EXCELSAOLVD1YAQY1AP 228-10358 - SQLSVRSTD 2014 ENG OLP NL LCLGOV
065-06441 - EXCELSAOLVD1YAQY2AP 228-10343 - SQLSVRSTD 2014 SNGL OLP C
065-06440 - EXCELSAOLVD1YAQY3AP 228-10344 - SQLSVRSTD 2014 SNGL OLP NL
065-06442 - EXCELSAOLVD2YAQY2AP 228-08899 - SQLSVRSTD ALNG LICSAPK OLV C 1Y AP
065-06443 - EXCELSAOLVD3YAQY1AP 228-07279 - SQLSVRSTD ALNG LICSAPK OLV D 1Y AP
065-06811 - EXCELSNGLLICSAPKOLVC1YAQY1AP 7NQ-00123 - SQLSVRSTD ALNG LICSK OLV 2LIC 1Y CRELIC
065-06833 - EXCELSNGLLICSAPKOLVC1YAQY2AP 7NQ-00146 - SQLSVRSTD ALNG LICSK OLV 2LICD 1Y CRELIC
065-06855 - EXCELSNGLLICSAPKOLVC1YAQY3AP 7NQ-00122 - SQLSVRSTD ANG LICSK OLV 2LIC C 1Y CRELIC
065-06879 - EXCELSNGLLICSAPKOLVC2YAQY2AP 7NQ-00287 - SQLSVRSTD LICSAPK OLP 2LIC LCLGOV CRELIC
065-06901 - EXCELSNGLLICSAPKOLVC3YAQY1AP 7NQ-00214 - SQLSVRSTD SNGL LICSAPK OLP 2LIC C CRELIC
065-06812 - EXCELSNGLSAOLVC1YAQY1AP 7NQ-00215 - SQLSVRSTD SNGL LICSAPK OLP 2LIC CRELIC
065-06834 - EXCELSNGLSAOLVC1YAQY2AP 7NQ-00483 - SQLSVRSTDCORE 2014 ENG DISKKIT MVL DVD
065-06856 - EXCELSNGLSAOLVC1YAQY3AP 7NQ-00562 - SQLSVRSTDCORE 2014 SNGL2LIC C CORELIC
065-06880 - EXCELSNGLSAOLVC2YAQY2AP 7NQ-00288 - SQLSVRSTDCORE SA OLP 2LIC LCLGOV CORELIC
065-06902 - EXCELSNGLSAOLVC3YAQY1AP 7NQ-00216 - SQLSVRSTDCORE SNGL SA OLP 2LIC C CORELIC
381-02252 - EXCHANGE CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL 7NQ-00217 - SQLSVRSTDCORE SNGL SA OLP 2LIC CORELIC
381-02257 - EXCHANGE CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL 228-07281 - SQLSVRSTDLICSAPKOLVD1YAQY1AP
381-02250 - EXCHANGE CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL 228-07282 - SQLSVRSTDLICSAPKOLVD1YAQY2AP
381-02255 - EXCHANGE CAL ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL 228-07283 - SQLSVRSTDLICSAPKOLVD1YAQY3AP
381-02260 - EXCHANGE CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD DEVICE CAL 228-07284 - SQLSVRSTDLICSAPKOLVD2YAQY2AP
381-02265 - EXCHANGE CAL ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD USER CAL 228-07285 - SQLSVRSTDLICSAPKOLVD3YAQY1AP
381-02262 - EXCHANGE CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD DEVICE CAL 228-07274 - SQLSVRSTDSAOLVD1YAQY1AP
381-02267 - EXCHANGE CAL ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD USER CAL 228-07275 - SQLSVRSTDSAOLVD1YAQY2AP
PGI-00536 - EXCHANGE ENTERPRISE CAL ALL LNG LIC 228-07276 - SQLSVRSTDSAOLVD1YAQY3AP
PGI-00539 - EXCHANGE ENTERPRISE CAL ALL LNG LICENSE 228-07277 - SQLSVRSTDSAOLVD2YAQY2AP
395-02391 - Exchange Server For Windows Enterprise Edition Software Assurance 32-Bit Win Lic 228-07278 - SQLSVRSTDSAOLVD3YAQY1AP
395-02428 - Exchange Server For Windows Enterprise Edition Software Assurance 32-Bit Win Lic 228-08833 - SQLSVRSTDSNGLLICSAPKOLVC1YAQY1AP
395-02467 - Exchange Server For Windows Enterprise Edition Software Assurance 32-Bit Win Lic 228-08863 - SQLSVRSTDSNGLLICSAPKOLVC1YAQY2AP
395-02520 - Exchange Server For Windows Enterprise Edition Software Assurance 32-Bit Win Lic 228-08893 - SQLSVRSTDSNGLLICSAPKOLVC1YAQY3AP
395-02548 - Exchange Server For Windows Enterprise Edition Software Assurance 32-Bit Win Lic 228-08925 - SQLSVRSTDSNGLLICSAPKOLVC2YAQY2AP
395-02556 - Exchange Server For Windows Enterprise Edition Software Assurance 32-Bit Win Lic 228-08955 - SQLSVRSTDSNGLLICSAPKOLVC3YAQY1AP
312-02138 - Exchange Server For Windows Standard Software Assurance 32-Bit Win License Only 228-08837 - SQLSVRSTDSNGLSAOLVC1YAQY1AP
312-02198 - Exchange Server For Windows Standard Software Assurance 32-Bit Win License Only 228-08867 - SQLSVRSTDSNGLSAOLVC1YAQY2AP
312-02201 - Exchange Server For Windows Standard Software Assurance 32-Bit Win License Only 228-08897 - SQLSVRSTDSNGLSAOLVC1YAQY3AP
312-02269 - Exchange Server For Windows Standard Software Assurance 32-Bit Win License Only 228-08929 - SQLSVRSTDSNGLSAOLVC2YAQY2AP
312-02300 - Exchange Server For Windows Standard Software Assurance 32-Bit Win License Only 228-08959 - SQLSVRSTDSNGLSAOLVC3YAQY1AP
312-02303 - Exchange Server For Windows Standard Software Assurance 32-Bit Win License Only A5M-00675 - SQLWORKGROUPCALWIN32ENGLISHSAOLVNL1YRACQ
381-02251 - EXCHANGE STAND CAL ENGLISH LIC/SA OLVNL 2YRACQY2 ADDPRD DEVICE CA 7NQ-00585 - STDCORE 2014 ENG2LIC NL LCLGOV CORELIC
381-04124 - EXCHANGE STANDARD CAL 2010 ENGLISH MLP 5 DEVICE CAL 7NQ-00563 - STDCORE 2014 SNGL2LIC NL CORELIC QLFD
381-04125 - EXCHANGE STANDARD CAL 2010 ENGLISH MLP 5 USER CAL AAA-02675 - STEP UP TO THE NEWEST OFFICE TOOLS FOR GROWING YOUR BUSINESS AND STAYING PRODUCT
381-04237 - EXCHANGE STANDARD CAL ALL LNG LIC B17-00329 - Streets and Trips 2006 Win32 English Dell Only US Only CD w/Voice Command
381-04239 - EXCHANGE STANDARD CAL ALL LNG LIC B17-00234 - STREETS AND TRIPS ALL LNG LIC/SA PK OLV
381-04236 - EXCHANGE STANDARD CAL ALL LNG LIC/SOFT B17-00216 - STREETS AND TRIPS ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD
381-04235 - EXCHANGE STANDARD CAL ALL LNG LICENSE B17-00214 - STREETS AND TRIPS ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD
381-04234 - EXCHANGE STANDARD CAL ALL LNG LICENSE B17-00219 - STREETS AND TRIPS ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD
381-04238 - EXCHANGE STANDARD CAL ALL LNG LICENSE B17-00221 - STREETS AND TRIPS ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD
381-03386 - Exchange Standard CAL Eng Lic/SA Pack OLP C Device CAL B17-00217 - STREETSANDTRIPSENGLISHLIC/SAPACKOLVNL1YR
381-03397 - Exchange Standard CAL Eng Lic/SA Pack OLP C User CAL B17-00218 - STREETSANDTRIPSENGLISHLIC/SAPACKOLVNL1YR
381-03106 - Exchange Standard CAL Eng Lic/SA Pack OLP NL Device CAL B17-00588 - STSANDTRIPS 2013 ENG OLP NL LCLGOV
381-03102 - Exchange Standard CAL Eng Lic/SA Pack OLP NL Locl Govt Device CAL B17-00580 - STSANDTRIPS 2013 SNGL OLP C
381-03103 - Exchange Standard CAL Eng Lic/SA Pack OLP NL Locl Govt User CAL B17-00581 - STSANDTRIPS 2013 SNGL OLP NL
381-03107 - Exchange Standard CAL Eng Lic/SA Pack OLP NL User CAL B17-00579 - STSANDTRIPS 2013 SNGL OLP NL CHRTY
381-03104 - Exchange Standard CAL Eng SA OLP NL Locl Govt Device CAL B17-00483 - STSANDTRIPS ALNG LICSAPK OLV C 1Y AP
381-03105 - Exchange Standard CAL Eng SA OLP NL Locl Govt User CAL B17-00381 - STSANDTRIPS ALNG LICSAPK OLV D 1Y AP
381-02258 - EXCHANGE STANDARD CAL ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD USER CAL B17-00374 - STSANDTRIPSLICSAPKOLVD1YAQY2AP
381-03438 - Exchange Standard CAL English SA OLP C Device CAL B17-00375 - STSANDTRIPSLICSAPKOLVD1YAQY3AP
381-03449 - Exchange Standard CAL English SA OLP C User CAL B17-00372 - STSANDTRIPSLICSAPKOLVD2YAQY2AP
381-03108 - Exchange Standard CAL English SA OLP NL Device CAL B17-00380 - STSANDTRIPSSAOLVD1YAQY2AP
381-03109 - Exchange Standard CAL English SA OLP NL User CAL B17-00379 - STSANDTRIPSSAOLVD1YAQY3AP
381-02269 - EXCHANGE STANDARD CAL ENGLISH SA OLV NL 1YR ACQ Y2 ADDTL PROD USER CAL B17-00377 - STSANDTRIPSSAOLVD2YAQY2AP
312-03195 - EXCHANGE SVR ALL LNG LIC/SA PK OLV NL 1Y B17-00378 - STSANDTRIPSSAOLVD3YAQY1AP
312-03037 - EXCHANGE SVR ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD B17-00477 - STSANDTRIPSSNGLLICSAPKOLVC1YAQY1A
312-03038 - EXCHANGE SVR ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD B17-00479 - STSANDTRIPSSNGLLICSAPKOLVC1YAQY2A
312-03035 - EXCHANGE SVR ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD B17-00481 - STSANDTRIPSSNGLLICSAPKOLVC1YAQY3A
312-03040 - EXCHANGE SVR ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD B17-00484 - STSANDTRIPSSNGLLICSAPKOLVC2YAQY2A
312-03042 - EXCHANGE SVR ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD B17-00486 - STSANDTRIPSSNGLLICSAPKOLVC3YAQY1A
395-03516 - EXCHANGE SVR ENT ALL LNG LIC/SA PK OLV N B17-00478 - STSANDTRIPSSNGLSAOLVC1YAQY1AP
395-03276 - EXCHANGE SVR ENT ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD B17-00480 - STSANDTRIPSSNGLSAOLVC1YAQY2AP
395-03276 - EXCHANGE SVR ENT ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y1 ADDTL PROD B17-00482 - STSANDTRIPSSNGLSAOLVC1YAQY3AP
395-03277 - EXCHANGE SVR ENT ENGLISH LIC/SA PACK OLV NL 1YR ACQ Y2 ADDTL PROD B17-00485 - STSANDTRIPSSNGLSAOLVC2YAQY2AP
395-03274 - EXCHANGE SVR ENT ENGLISH LIC/SA PACK OLV NL 3YR ACQ Y1 ADDTL PROD B17-00487 - STSANDTRIPSSNGLSAOLVC3YAQY1AP
395-03284 - EXCHANGE SVR ENT ENGLISH SA OLV NL 1YR ACQ Y1 ADDTL PROD 7U6-00007 - SUBSVL OLP NL ANNUAL LCLGOV QLFD
395-03286 - EXCHANGE SVR ENT ENGLISH SA OLV NL 3YR ACQ Y1 ADDTL PROD 7U6-00002-12 - SUBSVL OLV NL 1MTH AP
395-03281 - EXCHANGE SVR ENT ENGLISH SA STEP UP OLV NL 1YR ACQ Y1 ADDTL PROD F52-02565 - SVRENT 2013R2 ENG 2LIC NL LCLGOV CORELIC
395-03279 - EXCHANGE SVR ENT ENGLISH SA STEP UP OLV NL 2YR ACQ Y2 ADDTL PROD MUY-00080 - SVRMGMTSTENTENGLCSAPCKOLVNL1YRACQY1ADDTL
395-03280 - EXCHANGE SVR ENT ENGLISH SA STEP UP OLV NL 3YR ACQ Y1 ADDTL PROD YEG-01235 - SVRPLUS LICSAPK OLV C 2Y AQY2 USR
381-02263 - EXCHANGESTANDARDCALENGLISHSAOLVNL1YRACQY YEG-01237 - SVRPLUS LICSAPK OLV D 2Y AQY2 DVC
381-02264 - EXCHANGESTANDARDCALENGLISHSAOLVNL1YRACQY YEG-01238 - SVRPLUS LICSAPK OLV D 2Y AQY2 USR
381-02268 - EXCHANGESTANDARDCALENGLISHSAOLVNL1YRACQY YEG-01236 - SVRPLUS LICSAPK OLV NL 2Y AQY2 USR
381-02266 - EXCHANGESTANDARDCALENGLISHSAOLVNL2YRACQY YEG-01215 - SVRPLUSAL LISAPK OLV 1Y
381-02261 - EXCHANGESTANDARDCALENGLISHSAOLVNL2YRACQY YEG-01213 - SVRPLUSAL LISAPK OLV 1Y DVAL
381-02259 - EXCHANGESTANDCALENGLISHLIC/SAOLVNL1YRACQ YEG-01275 - SVRPLUSAL LISAPK OLV 1Y FOREAL
381-02254 - EXCHANGESTANDCALENGLISHLIC/SAOLVNL1YRACQ YEG-01273 - SVRPLUSAL LISAPK OLV 1Y FOREAL DVAL
381-02253 - EXCHANGESTANDCALENGLISHLIC/SAOLVNL1YRACQ YEG-01219 - SVRPLUSAL LISAPK OLV 1Y UTD
381-02256 - EXCHANGESTANDCALENGLISHLIC/SAOLVNL2YRACQ YEG-01217 - SVRPLUSAL LISAPK OLV 1Y UTD DVAL
312-03039 - EXCHANGESVRENGLISHLIC/SAPACKOLVNL1YRACQY YEG-01279 - SVRPLUSAL LISAPK OLV 1Y UTD FOREAL
312-03036 - EXCHANGESVRENGLISHLIC/SAPACKOLVNL2YRACQY YEG-01277 - SVRPLUSAL LISAPK OLV 1Y UTD FOREAL DVAL
312-03044 - EXCHANGESVRENGLISHSAOLVNL1YRACQY2ADDTLPR YEG-01230 - SVRPLUSAL LISAPK OLV D 1Y
312-03043 - EXCHANGESVRENGLISHSAOLVNL1YRACQY3ADDTLPR YEG-01229 - SVRPLUSAL LISAPK OLV D 1Y DVAL
312-03041 - EXCHANGESVRENGLISHSAOLVNL2YRACQY2ADDTLPR YEG-01290 - SVRPLUSAL LISAPK OLV D 1Y FOREAL
395-03278 - EXCHANGESVRENTENGLISHLIC/SAPACKOLVNL1YRA YEG-01289 - SVRPLUSAL LISAPK OLV D 1Y FOREAL DVAL
395-03275 - EXCHANGESVRENTENGLISHLIC/SAPACKOLVNL2YRA YEG-01291 - SVRPLUSAL LISAPK OLV D 1Y FOREAL DVAL
395-03288 - EXCHANGESVRENTENGLISHSAOLVNL1YRACQY2ADDT YEG-01232 - SVRPLUSAL LISAPK OLV D 1Y UTD
395-03287 - EXCHANGESVRENTENGLISHSAOLVNL1YRACQY3ADDT YEG-01231 - SVRPLUSAL LISAPK OLV D 1Y UTD DVAL
395-03285 - EXCHANGESVRENTENGLISHSAOLVNL2YRACQY2ADDT YEG-01292 - SVRPLUSAL LISAPK OLV D 1Y UTD FOREAL
395-03282 - EXCHANGESVRENTENGLISHSASTEPUPOLVNL1YRACQ YEG-01216 - SVRPLUSAL LISAPK OLV NL 1Y
395-03283 - EXCHANGESVRENTENGLISHSASTEPUPOLVNL1YRACQ YEG-01214 - SVRPLUSAL LISAPK OLV NL 1Y DVAL
PGI-00619 - EXCHGENTCAL 2013OLP C DVCCAL WOSRVCS YEG-01276 - SVRPLUSAL LISAPK OLV NL 1Y FOREAL
PGI-00621 - EXCHGENTCAL 2013OLP C USRCAL WOSRVCS YEG-01278 - SVRPLUSAL LISAPK OLV NL 1Y FOREAL DVAL
PGI-00620 - EXCHGENTCAL 2013OLP NL DVCCAL WOSRVCS YEG-01274 - SVRPLUSAL LISAPK OLV NL 1Y FOREAL DVAL
PGI-00622 - EXCHGENTCAL 2013OLP NL USRCAL WOSRVCS YEG-01220 - SVRPLUSAL LISAPK OLV NL 1Y UTD
PGI-00141 - EXCHGENTCAL ALNG LICSAPK OLV C 1Y AP DVCCAL WSRVCS YEG-01218 - SVRPLUSAL LISAPK OLV NL 1Y UTD DVAL
PGI-00143 - EXCHGENTCAL ALNG LICSAPK OLV C 1Y AP USRCAL WSRVCS YEG-01280 - SVRPLUSAL LISAPK OLV NL 1Y UTD FOREAL
PGI-00169 - EXCHGENTCAL ALNG LICSAPK OLV D 1Y AP DVCCAL WSRVCS YEG-01197 - SVRPLUSCAL LICSAPK OLV C 1Y DVCCAL
PGI-00170 - EXCHGENTCAL ALNG LICSAPK OLV D 1Y AP USRCAL WSRVCS YEG-01199 - SVRPLUSCAL LICSAPK OLV C 1Y USRCAL
PGI-00142 - EXCHGENTCAL ALNG LICSAPK OLV NL 1Y AP DVCCAL WSRVCS YEG-01205 - SVRPLUSCAL LICSAPK OLV C 1Y AQY2 DVCCAL
PGI-00144 - EXCHGENTCAL ALNG LICSAPK OLV NL 1Y AP USRCAL WSRVCS YEG-01207 - SVRPLUSCAL LICSAPK OLV C 1Y AQY2 USRCAL
PGI-00515 - EXCHGENTCAL ENG LICSAPK OLP NL LCLGOV DVCCAL WOSRVCS YEG-01209 - SVRPLUSCAL LICSAPK OLV C 1Y AQY3 DVCCAL
PGI-00516 - EXCHGENTCAL ENG LICSAPK OLP NL LCLGOV USRCAL WOSRVCS YEG-01211 - SVRPLUSCAL LICSAPK OLV C 1Y AQY3 USRCAL
PGI-00517 - EXCHGENTCAL ENG SA OLP NL LCLGOV DVCCAL WOSRVCS YEG-01233 - SVRPLUSCAL LICSAPK OLV C 2Y AQY2 DVCCAL
PGI-00518 - EXCHGENTCAL ENG SA OLP NL LCLGOV USRCAL WOSRVCS YEG-01239 - SVRPLUSCAL LICSAPK OLV C 3Y DVCCAL
PGI-00149 - EXCHGENTCAL LICSAPK OLV D 1Y AQY1 AP DVCCAL WSRVCS YEG-01241 - SVRPLUSCAL LICSAPK OLV C 3Y USRCAL
PGI-00150 - EXCHGENTCAL LICSAPK OLV D 1Y AQY1 AP USRCAL WSRVCS YEG-01221 - SVRPLUSCAL LICSAPK OLV D 1Y DVCCAL
PGI-00157 - EXCHGENTCAL LICSAPK OLV D 1Y AQY2 AP DVCCAL WSRVCS YEG-01222 - SVRPLUSCAL LICSAPK OLV D 1Y USRCAL
PGI-00158 - EXCHGENTCAL LICSAPK OLV D 1Y AQY2 AP USRCAL WSRVCS YEG-01225 - SVRPLUSCAL LICSAPK OLV D 1Y AQY2 DVCCAL
PGI-00165 - EXCHGENTCAL LICSAPK OLV D 1Y AQY3 AP DVCCAL WSRVCS YEG-01226 - SVRPLUSCAL LICSAPK OLV D 1Y AQY2 USRCAL
PGI-00166 - EXCHGENTCAL LICSAPK OLV D 1Y AQY3 AP USRCAL WSRVCS YEG-01227 - SVRPLUSCAL LICSAPK OLV D 1Y AQY3 DVCCAL
PGI-00215 - EXCHGENTCAL LICSAPK OLV D 2Y AQY2 AP DVCCAL WSRVCS YEG-01228 - SVRPLUSCAL LICSAPK OLV D 1Y AQY3 USRCAL
PGI-00216 - EXCHGENTCAL LICSAPK OLV D 2Y AQY2 AP USRCAL WSRVCS YEG-01247 - SVRPLUSCAL LICSAPK OLV D 3Y DVCCAL
PGI-00263 - EXCHGENTCAL LICSAPK OLV D 3Y AQY1 AP DVCCAL WSRVCS YEG-01248 - SVRPLUSCAL LICSAPK OLV D 3Y USRCAL
PGI-00264 - EXCHGENTCAL LICSAPK OLV D 3Y AQY1 AP USRCAL WSRVCS YEG-01198 - SVRPLUSCAL LICSAPK OLV NL 1Y DVCCAL
PGI-00151 - EXCHGENTCAL SA OLV D 1Y AQY1 AP DVCCAL WSRVCS YEG-01200 - SVRPLUSCAL LICSAPK OLV NL 1Y USRCAL
PGI-00152 - EXCHGENTCAL SA OLV D 1Y AQY1 AP USRCAL WSRVCS YEG-01208 - SVRPLUSCAL LICSAPK OLV NL 1Y AQY2USRCAL
PGI-00159 - EXCHGENTCAL SA OLV D 1Y AQY2 AP DVCCAL WSRVCS YEG-01240 - SVRPLUSCAL LICSAPK OLV NL 3Y DVCCAL
PGI-00160 - EXCHGENTCAL SA OLV D 1Y AQY2 AP USRCAL WSRVCS YEG-01242 - SVRPLUSCAL LICSAPK OLV NL 3Y USRCAL
PGI-00167 - EXCHGENTCAL SA OLV D 1Y AQY3 AP DVCCAL WSRVCS YEG-01201 - SVRPLUSCAL SA OLV C 1Y DVCCAL
PGI-00168 - EXCHGENTCAL SA OLV D 1Y AQY3 AP USRCAL WSRVCS YEG-01203 - SVRPLUSCAL SA OLV C 1Y USRCAL
PGI-00217 - EXCHGENTCAL SA OLV D 2Y AQY2 AP DVCCAL WSRVCS YEG-01243 - SVRPLUSCAL SA OLV C 3Y DVCCAL
PGI-00218 - EXCHGENTCAL SA OLV D 2Y AQY2 AP USRCAL WSRVCS YEG-01245 - SVRPLUSCAL SA OLV C 3Y USRCAL
PGI-00265 - EXCHGENTCAL SA OLV D 3Y AQY1 AP DVCCAL WSRVCS YEG-01223 - SVRPLUSCAL SA OLV D 1Y DVCCAL
PGI-00266 - EXCHGENTCAL SA OLV D 3Y AQY1 AP USRCAL WSRVCS YEG-01224 - SVRPLUSCAL SA OLV D 1Y USRCAL
PGI-00424 - EXCHGENTCAL SNGL LICSAPK OLP C USRCAL WOSRVCS YEG-01249 - SVRPLUSCAL SA OLV D 3Y DVCCAL
PGI-00423 - EXCHGENTCAL SNGL LICSAPK OLP NL DVCCAL WOSRVCS YEG-01202 - SVRPLUSCAL SA OLV NL 1Y DVCCAL
PGI-00426 - EXCHGENTCAL SNGL LICSAPK OLP NL USRCAL WOSRVCS YEG-01204 - SVRPLUSCAL SA OLV NL 1Y USRCAL
PGI-00053 - EXCHGENTCAL SNGL LICSAPK OLV C 1Y AQY1 AP DVCCAL WSRVCS YEG-01244 - SVRPLUSCAL SA OLV NL 3Y DVCCAL
PGI-00055 - EXCHGENTCAL SNGL LICSAPK OLV C 1Y AQY1 AP USRCAL WSRVCS YEG-01246 - SVRPLUSCAL SA OLV NL 3Y USRCAL
PGI-00093 - EXCHGENTCAL SNGL LICSAPK OLV C 1Y AQY2 AP DVCCAL WSRVCS YEG-01206 - SVRPLUSCAL LICSAPK OLV NL 1Y AQY2 DVCCAL
PGI-00095 - EXCHGENTCAL SNGL LICSAPK OLV C 1Y AQY2 AP USRCAL WSRVCS YEG-01210 - SVRPLUSCAL LICSAPK OLV NL 1Y AQY3 DVCCAL
PGI-00133 - EXCHGENTCAL SNGL LICSAPK OLV C 1Y AQY3 AP DVCCAL WSRVCS YEG-01212 - SVRPLUSCAL LICSAPK OLV NL 1Y AQY3 USRCAL
PGI-00135 - EXCHGENTCAL SNGL LICSAPK OLV C 1Y AQY3 AP USRCAL WSRVCS YEG-01234 - SVRPLUSCAL LICSAPK OLV NL 2Y AQY2 DVCCAL
PGI-00203 - EXCHGENTCAL SNGL LICSAPK OLV C 2Y AQY2 AP DVCCAL WSRVCS D75-02278 - SVRSTD 2013R2 ENG 2LIC NL LCLGOV CORELIC
PGI-00205 - EXCHGENTCAL SNGL LICSAPK OLV C 2Y AQY2 AP USRCAL WSRVCS MFF-00587 - SYS CTR CLT MGMT SUITE ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICE
PGI-00251 - EXCHGENTCAL SNGL LICSAPK OLV C 3Y AQY1 AP DVCCAL WSRVCS MFF-00586 - SYS CTR CLT MGMT SUITE ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICE
PGI-00253 - EXCHGENTCAL SNGL LICSAPK OLV C 3Y AQY1 AP USRCAL WSRVCS MFF-00588 - SYS CTR CLT MGMT SUITE ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICE
PGI-00054 - EXCHGENTCAL SNGL LICSAPK OLV NL 1Y AQY1 AP DVCCAL WSRVCS MFF-00590 - SYS CTR CLT MGMT SUITE ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICE
PGI-00056 - EXCHGENTCAL SNGL LICSAPK OLV NL 1Y AQY1 AP USRCAL WSRVCS MFF-00585 - SYS CTR CLT MGMT SUITE ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICE
PGI-00094 - EXCHGENTCAL SNGL LICSAPK OLV NL 1Y AQY2 AP DVCCAL WSRVCS MFF-00589 - SYS CTR CLT MGMT SUITE ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE 1 LICE
PGI-00096 - EXCHGENTCAL SNGL LICSAPK OLV NL 1Y AQY2 AP USRCAL WSRVCS J5A-01182 - SYS CTR CONFIG MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VAL
PGI-00134 - EXCHGENTCAL SNGL LICSAPK OLV NL 1Y AQY3 AP DVCCAL WSRVCS J5A-01179 - SYS CTR CONFIG MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VAL
PGI-00136 - EXCHGENTCAL SNGL LICSAPK OLV NL 1Y AQY3 AP USRCAL WSRVCS J5A-01180 - SYS CTR CONFIG MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VAL
PGI-00204 - EXCHGENTCAL SNGL LICSAPK OLV NL 2Y AQY2 AP DVCCAL WSRVCS J5A-01181 - SYS CTR CONFIG MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VAL
PGI-00206 - EXCHGENTCAL SNGL LICSAPK OLV NL 2Y AQY2 AP USRCAL WSRVCS J5A-01183 - SYS CTR CONFIG MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VAL
PGI-00252 - EXCHGENTCAL SNGL LICSAPK OLV NL 3Y AQY1 AP DVCCAL WSRVCS J5A-01178 - SYS CTR CONFIG MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VAL
PGI-00254 - EXCHGENTCAL SNGL LICSAPK OLV NL 3Y AQY1 AP USRCAL WSRVCS TSC-01197 - SYS CTR DATA PRTCN MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN
PGI-00427 - EXCHGENTCAL SNGL SA OLP C DVCCAL WOSRVCS TSC-01193 - SYS CTR DATA PRTCN MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN
PGI-00430 - EXCHGENTCAL SNGL SA OLP C USRCAL WOSRVCS TSC-01196 - SYS CTR DATA PRTCN MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN
PGI-00429 - EXCHGENTCAL SNGL SA OLP NL DVCCAL WOSRVCS TSC-01192 - SYS CTR DATA PRTCN MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN
PGI-00432 - EXCHGENTCAL SNGL SA OLP NL USRCAL WOSRVCS TSC-01195 - SYS CTR DATA PRTCN MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN
PGI-00057 - EXCHGENTCAL SNGL SA OLV C 1Y AQY1 AP DVCCAL WSRVCS TSC-01194 - SYS CTR DATA PRTCN MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN
PGI-00059 - EXCHGENTCAL SNGL SA OLV C 1Y AQY1 AP USRCAL WSRVCS CVA-00374 - SYS CTR DPM S ML STD 2007 32-BIT/64 1PK
PGI-00097 - EXCHGENTCAL SNGL SA OLV C 1Y AQY2 AP DVCCAL WSRVCS DJA-01177 - SYS CTR ESSNTLS SVR ML 2010 ENGLISH MLP
PGI-00099 - EXCHGENTCAL SNGL SA OLV C 1Y AQY2 AP USRCAL WSRVCS 9TX-01351 - SYS CTR OPS MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE
PGI-00137 - EXCHGENTCAL SNGL SA OLV C 1Y AQY3 AP DVCCAL WSRVCS 9TX-01353 - SYS CTR OPS MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE
PGI-00139 - EXCHGENTCAL SNGL SA OLV C 1Y AQY3 AP USRCAL WSRVCS 9TX-01350 - SYS CTR OPS MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE
PGI-00207 - EXCHGENTCAL SNGL SA OLV C 2Y AQY2 AP DVCCAL WSRVCS 9TX-01348 - SYS CTR OPS MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE
PGI-00209 - EXCHGENTCAL SNGL SA OLV C 2Y AQY2 AP USRCAL WSRVCS 9TX-01349 - SYS CTR OPS MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE
PGI-00255 - EXCHGENTCAL SNGL SA OLV C 3Y AQY1 AP DVCCAL WSRVCS 9TX-01352 - SYS CTR OPS MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VALUE
PGI-00257 - EXCHGENTCAL SNGL SA OLV C 3Y AQY1 AP USRCAL WSRVCS 3ND-00740 - SYS CTR SERVICE MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA
PGI-00058 - EXCHGENTCAL SNGL SA OLV NL 1Y AQY1 AP DVCCAL WSRVCS 3ND-00739 - SYS CTR SERVICE MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA
PGI-00060 - EXCHGENTCAL SNGL SA OLV NL 1Y AQY1 AP USRCAL WSRVCS 3ND-00742 - SYS CTR SERVICE MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA
PGI-00098 - EXCHGENTCAL SNGL SA OLV NL 1Y AQY2 AP DVCCAL WSRVCS 3ND-00741 - SYS CTR SERVICE MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA
PGI-00100 - EXCHGENTCAL SNGL SA OLV NL 1Y AQY2 AP USRCAL WSRVCS 3ND-00743 - SYS CTR SERVICE MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA
PGI-00138 - EXCHGENTCAL SNGL SA OLV NL 1Y AQY3 AP DVCCAL WSRVCS 3ND-00744 - SYS CTR SERVICE MGR CLT MGMT LIC ALL LNG LICENSE/SOFTWARE ASSURANCE PACK OPEN VA
PGI-00140 - EXCHGENTCAL SNGL SA OLV NL 1Y AQY3 AP USRCAL WSRVCS SNA-00651 - SYS CTR VMM WKGRP 2008 R2 SP1 64BIT EN
PGI-00208 - EXCHGENTCAL SNGL SA OLV NL 2Y AQY2 AP DVCCAL WSRVCS CGA-00438 - SYS CTRPM SVR ML ENT 2007 32-BIT/64- 1PK
PGI-00210 - EXCHGENTCAL SNGL SA OLV NL 2Y AQY2 AP USRCAL WSRVCS CJA-00297 - SYSCTR VMMSVR MGMT LICENT SNGL LIC/SA PA
PGI-00256 - EXCHGENTCAL SNGL SA OLV NL 3Y AQY1 AP DVCCAL WSRVCS CJA-00299 - SYSCTR VMMSVR MGMT LICENT SNGL SA OLV NL
PGI-00258 - EXCHGENTCAL SNGL SA OLV NL 3Y AQY1 AP USRCAL WSRVCS MFF-00122 - SYSCTRCLTMGMTSTE ALNG LICSAPK OLV C 1Y AP PEROSE
Q6Y-00007 - EXCHGEOLP1 SBSVL OLP NL ANAL LCLGOV QLFD MFF-00124 - SYSCTRCLTMGMTSTE ALNG LICSAPK OLV C 1Y AP PERUSR
Q6Y-00003 - EXCHGEONLN1 SHRDSVR SUBSVL OLP ANL QLFD MFF-00230 - SYSCTRCLTMGMTSTE ALNG LICSAPK OLV D 1Y AP PEROSE
Q6Y-00005 - EXCHGEONLN1OPSBSVL OLV D 1MTH AP MFF-00231 - SYSCTRCLTMGMTSTE ALNG LICSAPK OLV D 1Y AP PERUSR
Q6Y-00004-12 - EXCHGEONLNPLAN1 SUBSVL OLV D 1MTH AP MFF-00123 - SYSCTRCLTMGMTSTE ALNG LICSAPK OLV NL 1Y AP PEROSE
Q6Y-00001-12 - EXCHGEONLNPLAN1OP SUBSVL OLV NL 1MTH AP MFF-00125 - SYSCTRCLTMGMTSTE ALNG LICSAPK OLV NL 1Y AP PERUSR
Q6Y-00002 - EXCHGEONLNPLAN1OPEN OLV NL 1MTH AP MFF-00478 - SYSCTRCLTMGMTSTE ENG LICSAPK OLP NL LCLGOV PEROSE
74G-00039 - EXCHGHSTDENCRYPTN ALNG SUBSVL OLV C 1MTH MFF-00479 - SYSCTRCLTMGMTSTE ENG LICSAPK OLP NL LCLGOV PERUSR
74G-00039 - EXCHGHSTDENCRYPTN ALNG SUBSVL OLV C 1MTH MFF-00480 - SYSCTRCLTMGMTSTE ENG SA OLP NL LCLGOV PEROSE
74G-00031 - EXCHGHSTDENCRYPTN ALNG SUBSVL OLV D 1MTH MFF-00481 - SYSCTRCLTMGMTSTE ENG SA OLP NL LCLGOV PERUSR
74G-00031 - EXCHGHSTDENCRYPTN ALNG SUBSVL OLV D 1MTH MFF-00140 - SYSCTRCLTMGMTSTE LICSAPK OLV D 1Y AQY1 AP PEROSE
74G-00007-12 - EXCHGHSTDENCRYPTN ALNG SUBSVL OLV NL 1MTH AP PERUSR MFF-00141 - SYSCTRCLTMGMTSTE LICSAPK OLV D 1Y AQY1 AP PERUSR
74G-00040 - EXCHGHSTDENCRYPTNSNGLSUBSVLOLVC1MTH MFF-00178 - SYSCTRCLTMGMTSTE LICSAPK OLV D 1Y AQY2 AP PEROSE
74G-00040 - EXCHGHSTDENCRYPTNSNGLSUBSVLOLVC1MTH MFF-00179 - SYSCTRCLTMGMTSTE LICSAPK OLV D 1Y AQY2 AP PERUSR
74G-00032 - EXCHGHSTDENCRYPTNSUBSVLOLVD1MTHAPP MFF-00186 - SYSCTRCLTMGMTSTE LICSAPK OLV D 1Y AQY3 AP PEROSE
74G-00032 - EXCHGHSTDENCRYPTNSUBSVLOLVD1MTHAPP MFF-00227 - SYSCTRCLTMGMTSTE LICSAPK OLV D 1Y AQY3 AP PERUSR
74H-00123 - EXCHGHSTDFILTERING ALNG SUBSVL OLV C 1MT MFF-00254 - SYSCTRCLTMGMTSTE LICSAPK OLV D 2Y AQY2 AP PEROSE
74H-00122 - EXCHGHSTDFILTERING ALNG SUBSVL OLV C 1MT MFF-00255 - SYSCTRCLTMGMTSTE LICSAPK OLV D 2Y AQY2 AP PERUSR
74H-00123 - EXCHGHSTDFILTERING ALNG SUBSVL OLV C 1MT MFF-00317 - SYSCTRCLTMGMTSTE LICSAPK OLV D 3Y AQY1 AP PEROSE
74H-00122 - EXCHGHSTDFILTERING ALNG SUBSVL OLV C 1MT MFF-00318 - SYSCTRCLTMGMTSTE LICSAPK OLV D 3Y AQY1 AP PERUSR
74H-00056 - EXCHGHSTDFILTERING ALNG SUBSVL OLV D 1MT MFF-00142 - SYSCTRCLTMGMTSTE SA OLV D 1Y AQY1 AP PEROSE
74H-00053 - EXCHGHSTDFILTERING ALNG SUBSVL OLV D 1MT MFF-00143 - SYSCTRCLTMGMTSTE SA OLV D 1Y AQY1 AP PERUSR
74H-00053 - EXCHGHSTDFILTERING ALNG SUBSVL OLV D 1MT MFF-00180 - SYSCTRCLTMGMTSTE SA OLV D 1Y AQY2 AP PEROSE
74H-00056 - EXCHGHSTDFILTERING ALNG SUBSVL OLV D 1MT MFF-00181 - SYSCTRCLTMGMTSTE SA OLV D 1Y AQY2 AP PERUSR